SPERT Antibody


Western Blot: SPERT Antibody [NBP2-85810] - Host: Rabbit. Target Name: SPERT. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

SPERT Antibody Summary

The immunogen is a synthetic peptide directed towards the middle region of mouse SPERT. Peptide sequence: ASQHSYPLNRFSSMPFDPMERPTSQADLELDYNPPRVQLSDEMFVFQDGR The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for SPERT Antibody

  • CBY2spermatid flower-like structure protein
  • chibby homolog 2
  • FLJ35810
  • novel leucine zipper testicular protein
  • Protein chibby homolog 2
  • spermatid associated
  • spermatid-associated protein
  • testis specific leucine zipper protein nurit
  • testis-specific leucine zipper protein nurit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bt, Bv
Applications: ELISA, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IP

Publications for SPERT Antibody (NBP2-85810) (0)

There are no publications for SPERT Antibody (NBP2-85810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPERT Antibody (NBP2-85810) (0)

There are no reviews for SPERT Antibody (NBP2-85810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPERT Antibody (NBP2-85810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SPERT Products

Array NBP2-85810

Bioinformatics Tool for SPERT Antibody (NBP2-85810)

Discover related pathways, diseases and genes to SPERT Antibody (NBP2-85810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPERT Antibody (NBP2-85810)

Discover more about diseases related to SPERT Antibody (NBP2-85810).

Blogs on SPERT

There are no specific blogs for SPERT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPERT Antibody and receive a gift card or discount.


Gene Symbol SPERT