Sperm-associated antigen 7 Antibody

Images

 
Western Blot: Sperm-associated antigen 7 Antibody [NBP2-56171] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Sperm-associated antigen 7 Antibody [NBP2-56171] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sperm-associated antigen 7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGC
Specificity
Specificity of human Sperm-associated antigen 7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Sperm-associated antigen 7 Knockout 293T Cell Lysate
Control Peptide
Sperm-associated antigen 7 Recombinant Protein Antigen (NBP2-56171PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Sperm-associated antigen 7 Antibody

  • ACRP
  • FSA-1
  • MGC20134
  • sperm associated antigen 7
  • sperm-associated antigen 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-94173
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-88523
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1144
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-77089
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-36528
Species: Hu, Mu
Applications: IP (-), WB
NBP1-79022
Species: Hu, Mu
Applications: WB, IP
NBP1-48008
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, KD
H00007775-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF2228
Species: Hu
Applications: WB, IHC, ICC
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, Flow-IC
NBP2-56171
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Sperm-associated antigen 7 Antibody (NBP2-56171) (0)

There are no publications for Sperm-associated antigen 7 Antibody (NBP2-56171).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sperm-associated antigen 7 Antibody (NBP2-56171) (0)

There are no reviews for Sperm-associated antigen 7 Antibody (NBP2-56171). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sperm-associated antigen 7 Antibody (NBP2-56171) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Sperm-associated antigen 7 Products

Bioinformatics Tool for Sperm-associated antigen 7 Antibody (NBP2-56171)

Discover related pathways, diseases and genes to Sperm-associated antigen 7 Antibody (NBP2-56171). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sperm-associated antigen 7 Antibody (NBP2-56171)

Discover more about diseases related to Sperm-associated antigen 7 Antibody (NBP2-56171).
 

Pathways for Sperm-associated antigen 7 Antibody (NBP2-56171)

View related products by pathway.

Blogs on Sperm-associated antigen 7

There are no specific blogs for Sperm-associated antigen 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sperm-associated antigen 7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG7