Speedy/Ringo Antibody

Images

 
Western Blot: Speedy/Ringo Antibody [NBP1-53138] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Speedy/Ringo Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53138
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Speedy/Ringo Antibody Summary

Immunogen
Synthetic peptides corresponding to SPDYA(speedy homolog A (Drosophila)) The peptide sequence was selected from the N terminal of SPDYA. Peptide sequence MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT.
Clonality
Polyclonal
Host
Rabbit
Gene
SPDYA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SPDYA and was validated on Western blot.
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Speedy/Ringo Antibody

  • hSpy/Ringo A
  • MGC110856
  • Rapid inducer of G2/M progression in oocytes A
  • RINGO A
  • RINGO3
  • SPDY1
  • speedy homolog 1 (Drosophila)
  • speedy homolog A (Xenopus laevis)
  • speedy protein A
  • speedy-1
  • Spy1
  • SPY1MGC57218

Background

SPDYA regulates the G1/S phase transition of the cell cycle by binding and activating CDC2, CDK2 and CDKN1B/KIP1. SPDYA can activate CDK2 without promoting CDK2 phosphorylation. SPDYA mediates cell survival during the DNA damage process through activation of CDK2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1555
Species: Hu
Applications: WB
NB100-2521
Species: Hu, Mu, Rt, Sh
Applications: WB, ICC/IF, IHC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86241
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC

Publications for Speedy/Ringo Antibody (NBP1-53138) (0)

There are no publications for Speedy/Ringo Antibody (NBP1-53138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Speedy/Ringo Antibody (NBP1-53138) (0)

There are no reviews for Speedy/Ringo Antibody (NBP1-53138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Speedy/Ringo Antibody (NBP1-53138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Speedy/Ringo Products

Bioinformatics Tool for Speedy/Ringo Antibody (NBP1-53138)

Discover related pathways, diseases and genes to Speedy/Ringo Antibody (NBP1-53138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Speedy/Ringo Antibody (NBP1-53138)

Discover more about diseases related to Speedy/Ringo Antibody (NBP1-53138).
 

Pathways for Speedy/Ringo Antibody (NBP1-53138)

View related products by pathway.

PTMs for Speedy/Ringo Antibody (NBP1-53138)

Learn more about PTMs related to Speedy/Ringo Antibody (NBP1-53138).
 

Research Areas for Speedy/Ringo Antibody (NBP1-53138)

Find related products by research area.

Blogs on Speedy/Ringo

There are no specific blogs for Speedy/Ringo, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Speedy/Ringo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDYA
Uniprot