SPDYE2 Antibody (NBP2-46794)

Images

 
Immunohistochemistry: SPDYE2 Antibody [NBP2-46794] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG
Immunohistochemistry: SPDYE2 Antibody [NBP2-46794] - Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPDYE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPDYE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPDYE2 Antibody

  • MGC119295
  • putative Speedy protein E2
  • speedy homolog E2 (Xenopus laevis)
  • speedy protein E2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SPDYE2 Antibody (NBP2-46794) (0)

There are no publications for SPDYE2 Antibody (NBP2-46794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPDYE2 Antibody (NBP2-46794) (0)

There are no reviews for SPDYE2 Antibody (NBP2-46794). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPDYE2 Antibody (NBP2-46794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPDYE2 Products

Bioinformatics Tool for SPDYE2 Antibody (NBP2-46794)

Discover related pathways, diseases and genes to SPDYE2 Antibody (NBP2-46794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SPDYE2

There are no specific blogs for SPDYE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDYE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDYE2
Entrez
Uniprot