spatial Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: spatial Antibody [NBP2-14505] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: spatial Antibody [NBP2-14505] - Staining of human testis shows strong nuclear positivity in subsets of cells in seminiferus ducts.

Product Details

Summary
Product Discontinued
View other related spatial Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14505
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

spatial Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRAL RTPKPQTPGTYCFGRLSHHSFFSRHH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBATA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for spatial Antibody

  • C10orf27
  • spatial
  • TBATA thymus, brain and testes associated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP2-49443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6519
Species: Hu, Mu
Applications: WB, IHC
NBP1-81409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-43666
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
AF6486
Species: Hu
Applications: WB, Simple Western
26520002
Species: Hu
Applications: WB, ELISA
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for spatial Antibody (NBP2-14505) (0)

There are no publications for spatial Antibody (NBP2-14505).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for spatial Antibody (NBP2-14505) (0)

There are no reviews for spatial Antibody (NBP2-14505). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for spatial Antibody (NBP2-14505) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Bioinformatics Tool for spatial Antibody (NBP2-14505)

Discover related pathways, diseases and genes to spatial Antibody (NBP2-14505). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for spatial Antibody (NBP2-14505)

View related products by pathway.

Blogs on spatial

There are no specific blogs for spatial, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our spatial Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBATA