Recombinant Human SPAG8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SPAG8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 321-421 of Human SPAG8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SPAG8

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SPAG8 Protein

  • BS-84
  • HSD-1MGC26201
  • hSMP-1
  • SMP1
  • SMP-1
  • SPAG3
  • sperm associated antigen 8
  • Sperm membrane protein 1
  • Sperm membrane protein BS-84
  • sperm-associated antigen 8

Background

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein encoded by this gene is recognized by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07087
Species: Hu
NBP1-69668
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF4064
Species: Mu
Applications: WB, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7450
Species: Hu
Applications: IHC
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
MAB8630
Species: Hu
Applications: WB, IHC
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB3838
Species: Rt
Applications: WB, IHC
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready

Publications for SPAG8 Partial Recombinant Protein (H00026206-Q01) (0)

There are no publications for SPAG8 Partial Recombinant Protein (H00026206-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG8 Partial Recombinant Protein (H00026206-Q01) (0)

There are no reviews for SPAG8 Partial Recombinant Protein (H00026206-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPAG8 Partial Recombinant Protein (H00026206-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SPAG8 Products

Bioinformatics Tool for SPAG8 Partial Recombinant Protein (H00026206-Q01)

Discover related pathways, diseases and genes to SPAG8 Partial Recombinant Protein (H00026206-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG8 Partial Recombinant Protein (H00026206-Q01)

Discover more about diseases related to SPAG8 Partial Recombinant Protein (H00026206-Q01).
 

Pathways for SPAG8 Partial Recombinant Protein (H00026206-Q01)

View related products by pathway.

PTMs for SPAG8 Partial Recombinant Protein (H00026206-Q01)

Learn more about PTMs related to SPAG8 Partial Recombinant Protein (H00026206-Q01).

Blogs on SPAG8

There are no specific blogs for SPAG8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SPAG8 Antibody
NBP2-20464

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SPAG8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG8