Recombinant Human SP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 71-161 of Human SP2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SP2 Protein

  • KIAA0048
  • Sp2 transcription factor
  • transcription factor Sp2

Background

This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86613
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00006668-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for SP2 Partial Recombinant Protein (H00006668-Q01) (0)

There are no publications for SP2 Partial Recombinant Protein (H00006668-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP2 Partial Recombinant Protein (H00006668-Q01) (0)

There are no reviews for SP2 Partial Recombinant Protein (H00006668-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP2 Partial Recombinant Protein (H00006668-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SP2 Products

Bioinformatics Tool for SP2 Partial Recombinant Protein (H00006668-Q01)

Discover related pathways, diseases and genes to SP2 Partial Recombinant Protein (H00006668-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP2 Partial Recombinant Protein (H00006668-Q01)

Discover more about diseases related to SP2 Partial Recombinant Protein (H00006668-Q01).
 

Pathways for SP2 Partial Recombinant Protein (H00006668-Q01)

View related products by pathway.

PTMs for SP2 Partial Recombinant Protein (H00006668-Q01)

Learn more about PTMs related to SP2 Partial Recombinant Protein (H00006668-Q01).

Blogs on SP2

There are no specific blogs for SP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP2 Antibody
NBP1-83054
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SP2