SP110 Antibody (4B8)

Images

 
ELISA: SP110 Antibody (4B8) [H00003431-M04] - Detection limit for recombinant GST tagged SP110 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related SP110 Primary Antibodies

Order Details


    • Catalog Number
      H00003431-M04
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SP110 Antibody (4B8) Summary

Immunogen
SP110 (NP_004501 271 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Specificity
SP110 - SP110 nuclear body protein (4B8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SP110
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP110 Antibody (4B8)

  • FLJ22835
  • IFI41
  • IFI75
  • interferon-induced protein 41, 30kD
  • Interferon-induced protein 41/75
  • interferon-induced protein 75, 52kD
  • IPR1
  • phosphoprotein 41
  • phosphoprotein 75
  • SP110 nuclear body protein
  • Speckled 110 kDa
  • Transcriptional coactivator Sp110
  • VODI

Background

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-86060
Species: Hu
Applications: WB, IHC, IHC-P, Micro
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00004498-R01
Species: Hu
NB100-1813
Species: Hu
Applications: WB, IP
NB100-61050
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF839
Species: Hu
Applications: WB
NLS418
Species: Hu
Applications: IHC-P
NBP2-57248
Species: Hu
Applications: WB, ICC/IF
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
594-ML/CF
Species: Mu
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-01787
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for SP110 Antibody (H00003431-M04) (0)

There are no publications for SP110 Antibody (H00003431-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP110 Antibody (H00003431-M04) (0)

There are no reviews for SP110 Antibody (H00003431-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP110 Antibody (H00003431-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP110 Products

Bioinformatics Tool for SP110 Antibody (H00003431-M04)

Discover related pathways, diseases and genes to SP110 Antibody (H00003431-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP110 Antibody (H00003431-M04)

Discover more about diseases related to SP110 Antibody (H00003431-M04).
 

Pathways for SP110 Antibody (H00003431-M04)

View related products by pathway.

PTMs for SP110 Antibody (H00003431-M04)

Learn more about PTMs related to SP110 Antibody (H00003431-M04).

Blogs on SP110

There are no specific blogs for SP110, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP110 Antibody (4B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SP110
Entrez
Uniprot