Recombinant Human SP100 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SP100 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-98 of Human SP100

Source: Wheat Germ

Amino Acid Sequence: MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SP100
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SP100 Protein

  • DKFZp686E07254
  • FLJ00340
  • FLJ34579
  • lysp100b
  • nuclear antigen Sp100
  • nuclear autoantigen Sp-100
  • Nuclear dot-associated Sp100 protein
  • SP100 nuclear antigen
  • SP100-HMG nuclear autoantigen
  • Speckled 100 kDa

Background

SP100 - nuclear antigen Sp100

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-66340
Species: Hu
NB100-56136
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-81275
Species: Hu
Applications: IHC, IHC-P
NB100-2518
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP2-19499
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF8198
Species: Hu
Applications: ELISA, IHC
NBP1-32905
Species: Hu, Bv, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-812
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for SP100 Partial Recombinant Protein (H00006672-Q01) (0)

There are no publications for SP100 Partial Recombinant Protein (H00006672-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP100 Partial Recombinant Protein (H00006672-Q01) (0)

There are no reviews for SP100 Partial Recombinant Protein (H00006672-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SP100 Partial Recombinant Protein (H00006672-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SP100 Partial Recombinant Protein (H00006672-Q01)

Discover related pathways, diseases and genes to SP100 Partial Recombinant Protein (H00006672-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP100 Partial Recombinant Protein (H00006672-Q01)

Discover more about diseases related to SP100 Partial Recombinant Protein (H00006672-Q01).
 

Pathways for SP100 Partial Recombinant Protein (H00006672-Q01)

View related products by pathway.

PTMs for SP100 Partial Recombinant Protein (H00006672-Q01)

Learn more about PTMs related to SP100 Partial Recombinant Protein (H00006672-Q01).

Blogs on SP100

There are no specific blogs for SP100, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP100 Antibody
NBP1-86060

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SP100 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SP100