SP1 Antibody (1G9)

Images

 
Immunocytochemistry/ Immunofluorescence: SP1 Antibody (1G9) [H00006667-M11] - Analysis of monoclonal antibody to SP1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Product Discontinued
View other related SP1 Primary Antibodies

Order Details


    • Catalog Number
      H00006667-M11
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SP1 Antibody (1G9) Summary

Immunogen
SP1 (NP_612482, 522 a.a. - 618 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
Specificity
SP1 (1G9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP1 Antibody (1G9)

  • Sp1 transcription factor
  • specificity protein 1
  • transcription factor Sp1
  • TSFP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4256
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB4077
Species: Hu
Applications: WB, IHC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
H00006667-M11
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SP1 Antibody (H00006667-M11) (0)

There are no publications for SP1 Antibody (H00006667-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP1 Antibody (H00006667-M11) (0)

There are no reviews for SP1 Antibody (H00006667-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SP1 Antibody (H00006667-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP1 Products

Bioinformatics Tool for SP1 Antibody (H00006667-M11)

Discover related pathways, diseases and genes to SP1 Antibody (H00006667-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP1 Antibody (H00006667-M11)

Discover more about diseases related to SP1 Antibody (H00006667-M11).
 

Pathways for SP1 Antibody (H00006667-M11)

View related products by pathway.

PTMs for SP1 Antibody (H00006667-M11)

Learn more about PTMs related to SP1 Antibody (H00006667-M11).
 

Research Areas for SP1 Antibody (H00006667-M11)

Find related products by research area.

Blogs on SP1.

Nur77 Activation and Tumor Suppression
Nur77 is a member of the steroid/thyroid hormone phosphoprotein receptor superfamily. It is heavily post-translationally modified and rapidly induced in response to androgens and growth factors. It governs fundamental processes such as cell proliferat...  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP1 Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SP1
Entrez
OMIM
Uniprot