SP-D Antibody (2C10) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related SP-D Primary Antibodies

Order Details


    • Catalog Number
      H00006441-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SP-D Antibody (2C10) [PE] Summary

Immunogen
SFTPD (AAH22318.1, 21 a.a. - 375 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGKPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Specificity
SFTPD - surfactant, pulmonary-associated protein D
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SFTPD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SP-D Antibody (2C10) [PE]

  • COLEC7collectin-7
  • Collectin 7
  • Collectin-7
  • Lung surfactant protein D
  • PSPD
  • PSP-D
  • SFTP4
  • SFTP4pulmonary surfactant-associated protein D
  • SFTPD
  • SPD
  • SP-D
  • SP-Dpulmonary surfactant apoprotein
  • surfactant protein D
  • surfactant, pulmonary-associated protein D
  • surfactant-associated protein, pulmonary 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
MAB4218
Species: Hu
Applications: WB, IHC
NBP1-22568
Species: Hu
Applications: IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
MAB59151
Species: Mu
Applications: WB
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SP-D Antibody (H00006441-M03PE) (0)

There are no publications for SP-D Antibody (H00006441-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SP-D Antibody (H00006441-M03PE) (0)

There are no reviews for SP-D Antibody (H00006441-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SP-D Antibody (H00006441-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SP-D Products

Bioinformatics Tool for SP-D Antibody (H00006441-M03PE)

Discover related pathways, diseases and genes to SP-D Antibody (H00006441-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SP-D Antibody (H00006441-M03PE)

Discover more about diseases related to SP-D Antibody (H00006441-M03PE).
 

Pathways for SP-D Antibody (H00006441-M03PE)

View related products by pathway.

Research Areas for SP-D Antibody (H00006441-M03PE)

Find related products by research area.

Blogs on SP-D

There are no specific blogs for SP-D, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SP-D Antibody (2C10) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPD
Entrez