SOX8 Antibody (8G7) [DyLight 350]

Images

 

Product Details

Summary
Product Discontinued
View other related SOX8 Primary Antibodies

Order Details


    • Catalog Number
      H00030812-M01UV
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SOX8 Antibody (8G7) [DyLight 350] Summary

Immunogen
SOX8 (NP_055402, 102 a.a. ~ 211 a.a) partial recombinant protein with GST tag.VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLL SESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSD SDSGAELGPHPGGGAVYKAEAGLGD
Specificity
SOX8 - SRY (sex determining region Y)-box 8
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 350
Format
DyLight 350 (A=353, E=432)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX8 Antibody (8G7) [DyLight 350]

  • MGC24837
  • SRY (sex determining region Y)-box 8
  • transcription factor SOX-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85551
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2864
Species: Hu
Applications: WB, ICC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC
AF5286
Species: Hu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
H00007536-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-85811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89506
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
AF5077
Species: Hu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00030812-M01UV
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SOX8 Antibody (H00030812-M01UV) (0)

There are no publications for SOX8 Antibody (H00030812-M01UV).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX8 Antibody (H00030812-M01UV) (0)

There are no reviews for SOX8 Antibody (H00030812-M01UV). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX8 Antibody (H00030812-M01UV) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX8 Antibody (8G7) [DyLight 350] Products

Related Products by Gene

Bioinformatics Tool for SOX8 Antibody (H00030812-M01UV)

Discover related pathways, diseases and genes to SOX8 Antibody (H00030812-M01UV). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX8 Antibody (H00030812-M01UV)

Discover more about diseases related to SOX8 Antibody (H00030812-M01UV).
 

Pathways for SOX8 Antibody (H00030812-M01UV)

View related products by pathway.

PTMs for SOX8 Antibody (H00030812-M01UV)

Learn more about PTMs related to SOX8 Antibody (H00030812-M01UV).

Blogs on SOX8

There are no specific blogs for SOX8, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SOX8

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00030812-M01UV below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.