SOX8 Antibody (8G7) [DyLight 350]

Images

 

Product Details

Summary
Product Discontinued
View other related SOX8 Primary Antibodies

Order Details


    • Catalog Number
      H00030812-M01UV
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SOX8 Antibody (8G7) [DyLight 350] Summary

Immunogen
SOX8 (NP_055402, 102 a.a. ~ 211 a.a) partial recombinant protein with GST tag.VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLL SESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSD SDSGAELGPHPGGGAVYKAEAGLGD
Specificity
SOX8 - SRY (sex determining region Y)-box 8
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Conjugate
DyLight 350
Format
DyLight 350 (A=353, E=432)
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX8 Antibody (8G7) [DyLight 350]

  • MGC24837
  • SRY (sex determining region Y)-box 8
  • transcription factor SOX-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3075
Species: Hu
Applications: WB, ICC
AF2864
Species: Hu
Applications: WB, ICC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC
AF5286
Species: Hu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
NBP1-86835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-89506
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
AF5077
Species: Hu
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00030812-M01UV
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SOX8 Antibody (H00030812-M01UV) (0)

There are no publications for SOX8 Antibody (H00030812-M01UV).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX8 Antibody (H00030812-M01UV) (0)

There are no reviews for SOX8 Antibody (H00030812-M01UV). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SOX8 Antibody (H00030812-M01UV) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX8 Antibody (8G7) [DyLight 350] Products

Related Products by Gene

Bioinformatics Tool for SOX8 Antibody (H00030812-M01UV)

Discover related pathways, diseases and genes to SOX8 Antibody (H00030812-M01UV). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX8 Antibody (H00030812-M01UV)

Discover more about diseases related to SOX8 Antibody (H00030812-M01UV).
 

Pathways for SOX8 Antibody (H00030812-M01UV)

View related products by pathway.

PTMs for SOX8 Antibody (H00030812-M01UV)

Learn more about PTMs related to SOX8 Antibody (H00030812-M01UV).

Blogs on SOX8.

The use of a GFP antibody for research applications in transgenic C. elegans, GFP tagged yeast and porcine model
GFP, or green fluorescent protein, is a chemiluminescent protein derived from Aequorea jellyfish that was first discovered by Osamu Shimomura.  It was soon after established that the emission spectra of GFP was right around 509nm, or the ultraviol...  Read full blog post.

Contact Information

Product PDFs

Review this Product

Be the first to review our SOX8 Antibody (8G7) [DyLight 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX8