We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human SOX2 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related SOX2 Peptides and Proteins

Order Details


    • Catalog Number
      H00006657-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SOX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 155-245 of Human SOX2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVK

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
SOX2

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOX2 Protein

  • ANOP3
  • MCOPS3
  • MGC2413
  • SOX2
  • SRY (sex determining region Y)-box 2
  • SRY-related HMG-box gene 2
  • transcription factor SOX2
  • transcription factor SOX-2

Background

SOX2 - SRY (sex determining region Y)-box 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
H00388112-B01P
Species: Hu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3158
Species: Mu
Applications: ChIP, ICC, IHC, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF3757
Species: Hu
Applications: ICC, Simple Western, WB
7734-LF
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
235-F4
Species: Hu
Applications: BA
NBP2-37357
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
AF2569
Species: Hu
Applications: ICC, WB
233-FB
Species: Hu
Applications: BA
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
314-BP
Species: Hu
Applications: BA, BA
H00006657-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for SOX2 Partial Recombinant Protein (H00006657-Q01) (0)

There are no publications for SOX2 Partial Recombinant Protein (H00006657-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX2 Partial Recombinant Protein (H00006657-Q01) (0)

There are no reviews for SOX2 Partial Recombinant Protein (H00006657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX2 Partial Recombinant Protein (H00006657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOX2 Products

Research Areas for SOX2 Partial Recombinant Protein (H00006657-Q01)

Find related products by research area.

Blogs on SOX2. Showing 1-10 of 13 blog posts - Show all blog posts.

Spheroids vs. Organoids: Which 3D Cell Culture Model is Best for You?
By Jennifer Jones, M.S.Spheroids and organoids are two words that, like “butter” and “margarine”, are often referred to interchangeably but have distinct meanings. The progression and adopt...  Read full blog post.


  Read full blog post.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Application Focus: New Methods for iPSC Differentiation, Inducing a Mammary Fate
Discovery of the Key to PluripotencyInduced pluripotent stem cells (iPSCs) may be generated from a wide range of fully differentiated cells, and under optimal conditions may be prompted to differentiate into virtu...  Read full blog post.

Stemness for Surviving Hypoxia: TGF-beta/Smad Signaling in Multiple Myeloma
By Jamshed Arslan Pharm.D. Multiple myeloma (MM) is a cancer of antibody-producing plasma cells. The bone marrow (BM) of MM patients is hypoxic, and MM cells overexpress many cancerous genes that are regulated by hy...  Read full blog post.

KLF4 as a transcription factor in stem cell differentiation
Kru¨ppel-like factors (KLFs) are evolutionarily conserved zinc finger transcription factors that play a role in cell differentiation, proliferation, and pluripotency. KLF4 has specifically been tied to many diverse cellular processes, including sel...  Read full blog post.

SOX2 - a stem cell transcription factor
The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al...  Read full blog post.

SOX2: an Important Stem Cell Transcription Factor
SOX2 is a transcription factor that is expressed by self-renewing and multipotent stem cells of the embryonic neuroepithelium. Sox-2 was found to be expressed by dividing neural progenitor cells. Constitutive expression of SOX2 has also been shown to ...  Read full blog post.

Sox2 and Oct4: Roles in Embryonic Stem Cell Pluripotency
Embryonic stem (ES) cells are cells derived from the inner cell mass of the blastocyst, an early-stage embryo. ES cells are distinguished from other cells due to their pluripotency, which is the ability to differentiate into any different type of cell...  Read full blog post.

Showing 1-10 of 13 blog posts - Show all blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX2