SOX10 Antibody

Images

 
Western Blot: SOX10 Antibody [H00006663-B01P] - Analysis of SOX10 expression in transfected 293T cell line by SOX10 polyclonal antibody. Lane 1: SOX10 transfected lysate(51.26 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX10 Antibody Summary

Immunogen
SOX10 (NP_008872.1, 1 a.a. - 466 a.a.) full-length human protein. MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SOX10
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX10 Antibody

  • DOM
  • MGC15649
  • PCWH
  • SOX10
  • SRY (sex determining region Y)-box 10
  • SRY-related HMG-box gene 10
  • transcription factor SOX-10
  • WS4
  • WS4C
  • WS4mouse, human homolog of

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
MAB5579
Species: Hu
Applications: ICC
AF3075
Species: Hu
Applications: WB, ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
AF482
Species: Mu
Applications: WB, IHC
AF2418
Species: Hu
Applications: WB, IHC, ChIP, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00030812-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-58020
Species: Hu
Applications: ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00006663-B01P
Species: Hu
Applications: WB

Publications for SOX10 Antibody (H00006663-B01P) (0)

There are no publications for SOX10 Antibody (H00006663-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX10 Antibody (H00006663-B01P) (0)

There are no reviews for SOX10 Antibody (H00006663-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX10 Antibody (H00006663-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX10 Products

Bioinformatics Tool for SOX10 Antibody (H00006663-B01P)

Discover related pathways, diseases and genes to SOX10 Antibody (H00006663-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX10 Antibody (H00006663-B01P)

Discover more about diseases related to SOX10 Antibody (H00006663-B01P).
 

Pathways for SOX10 Antibody (H00006663-B01P)

View related products by pathway.

PTMs for SOX10 Antibody (H00006663-B01P)

Learn more about PTMs related to SOX10 Antibody (H00006663-B01P).

Blogs on SOX10

There are no specific blogs for SOX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX10
Entrez
Uniprot