Sortilin Antibody

Images

 
Orthogonal Strategies: Western Blot: Sortilin Antibody [NBP1-89745] - Analysis in human cell lines SK-MEL-30 and PC-3 using anti-SORT1 antibody. Corresponding SORT1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: Sortilin Antibody [NBP1-89745] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Western Blot: Sortilin Antibody [NBP1-89745] - Analysis in human cell line SK-BR-3.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Sortilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
Specificity
Specificity of human Sortilin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Sortilin Lysate (NBP2-64616)
Control Peptide
Sortilin Protein (NBP1-89745PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sortilin Antibody

  • 100 kDa NT receptor
  • Glycoprotein 95
  • Gp95
  • Gp95LDLCQ6
  • Neurotensin receptor 3
  • NT3NTR3
  • Ntr3
  • SORT1
  • sortilin 1
  • Sortilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
7815-NG/CF
Species: Rt
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sortilin Antibody (NBP1-89745) (0)

There are no publications for Sortilin Antibody (NBP1-89745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sortilin Antibody (NBP1-89745) (0)

There are no reviews for Sortilin Antibody (NBP1-89745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sortilin Antibody (NBP1-89745). (Showing 1 - 2 of 2 FAQ).

  1. NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
    • HIER= heat induced epitope retrieval: http://www.novusbio.com/support/support-by-application/antigen-retrieval/protocol.html        Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.
  2. NBP1-89745 - what does "HIER" for the retrieval method of IHC-paraffin mean?
    • hier= heat induced epitope retrieval: http://www.novusbio.com/support/support-by-application/antigen-retrieval/protocol.html        Concept: Antigen Retrieval Protocol (HIER). Fixing proteins with formalin creates crosslinks. In the process of crosslinking, antigen in the tissue can be masked, restricting antibody-target binding. The impaired ability of the antibody to access its epitope can result in weak signal or false negative staining. To promote epitope availability and enhance immunogenicity, one of several antigen retrieval methods is used. Proteolytic-Induced Epitope Retrieval (PIER) is an enzymatic method of antigen retrieval which relies on enzymes such as proteinase K, trypsin, or pepsin to unmask antigen. Heat-Induced Epitope Retrieval (HIER) utilizes heat to promote epitope availability. Optimal retrieval conditions depend on the type of tissue, fixation, and antibody, necessitating optimization for each antigen.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Sortilin Antibody (NBP1-89745)

Discover related pathways, diseases and genes to Sortilin Antibody (NBP1-89745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sortilin Antibody (NBP1-89745)

Discover more about diseases related to Sortilin Antibody (NBP1-89745).
 

Pathways for Sortilin Antibody (NBP1-89745)

View related products by pathway.

PTMs for Sortilin Antibody (NBP1-89745)

Learn more about PTMs related to Sortilin Antibody (NBP1-89745).
 

Research Areas for Sortilin Antibody (NBP1-89745)

Find related products by research area.

Blogs on Sortilin

There are no specific blogs for Sortilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sortilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SORT1