Sortilin Antibody (CL6526)

Images

 
Western Blot: Sortilin Antibody (CL6526) [NBP2-76498] - Analysis in human cell line SK-MEL-30.
Immunocytochemistry/ Immunofluorescence: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of RH-30 cells using the Anti-SORT1 monoclonal antibody, showing specific staining of the golgi apparatus in green. ...read more
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of mouse hippocampus shows strong cytoplasmic positivity in both pyramidal neurons and granular cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Analysis in human cerebral cortex and lymph node tissues. Corresponding SORT1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of human lymph node shows only weak positivity in a subset of lymphoid cells, as expected.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6526) [NBP2-76498] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL6526
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Sortilin Antibody (CL6526) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
Epitope
CVEQPELKGHDLEFC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2b
Clonality
Monoclonal
Host
Mouse
Gene
SORT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89)% and Rat (89)%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Sortilin Antibody (CL6526)

  • 100 kDa NT receptor
  • Glycoprotein 95
  • Gp95
  • Gp95LDLCQ6
  • Neurotensin receptor 3
  • NT3NTR3
  • Ntr3
  • SORT1
  • sortilin 1
  • Sortilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NLS938
Species: Hu
Applications: IHC, IHC-P
MAB3468
Species: Hu
Applications: WB, ICC
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76498
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sortilin Antibody (NBP2-76498) (0)

There are no publications for Sortilin Antibody (NBP2-76498).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sortilin Antibody (NBP2-76498) (0)

There are no reviews for Sortilin Antibody (NBP2-76498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Sortilin Antibody (NBP2-76498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Sortilin Products

Bioinformatics Tool for Sortilin Antibody (NBP2-76498)

Discover related pathways, diseases and genes to Sortilin Antibody (NBP2-76498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sortilin Antibody (NBP2-76498)

Discover more about diseases related to Sortilin Antibody (NBP2-76498).
 

Pathways for Sortilin Antibody (NBP2-76498)

View related products by pathway.

PTMs for Sortilin Antibody (NBP2-76498)

Learn more about PTMs related to Sortilin Antibody (NBP2-76498).
 

Research Areas for Sortilin Antibody (NBP2-76498)

Find related products by research area.

Blogs on Sortilin

There are no specific blogs for Sortilin, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sortilin Antibody (CL6526) and receive a gift card or discount.

Bioinformatics

Gene Symbol SORT1