Sortilin Antibody (1B3)

Images

 
Western Blot: Sortilin Antibody (1B3) [H00006272-M01] - SORT1 monoclonal antibody (M01), clone 1B3. Analysis of SORT1 expression in human placenta.
Western Blot: Sortilin Antibody (1B3) [H00006272-M01] - SORT1 monoclonal antibody (M01), clone 1B3. Western Blot analysis of SORT1 expression in human spleen.
Western Blot: Sortilin Antibody (1B3) [H00006272-M01] - SORT1 monoclonal antibody (M01), clone 1B3. Analysis of SORT1 expression in rat brain.
ELISA: Sortilin Antibody (1B3) [H00006272-M01] - Detection limit for recombinant GST tagged SORT1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Sortilin Antibody (1B3) Summary

Immunogen
SORT1 (NP_002950 203 a.a. - 299 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI
Specificity
SORT1 - sortilin 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SORT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Control
Sortilin Lysate (NBP2-64616)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Sortilin Antibody (1B3)

  • 100 kDa NT receptor
  • Glycoprotein 95
  • Gp95
  • Gp95LDLCQ6
  • Neurotensin receptor 3
  • NT3NTR3
  • Ntr3
  • SORT1
  • sortilin 1
  • Sortilin

Background

This gene encodes a protein that is a multi-ligand type-1 receptor with similarity to the yeast carboxypeptidase Y sorting receptor Vps10 protein. The encoded protein, a trans-Golgi network (TGN) transmembrane protein, binds a number of unrelated ligands that participate in a wide range of cellular processes; however, it lacks the typical features of a signalling receptor. In the TGN, furin mediates the activation of the mature binding form. The encoded protein consists of a large luminal domain, a single transmembrane segment and short C-terminal cytoplasmic tail. The luminal domain contains a cysteine-rich region similar to two corresponding segments in the yeast Vps10p; the cytoplasmic tail is similar to the corresponding segment of the cation-independent mannose 6-phosphate receptor and the tail also interacts with the VHS domains of GGA (Golgi-associated, gamma-adaptin homologous, ARF-interacting) proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
7815-NG/CF
Species: Rt
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00001523-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-87382
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Sortilin Antibody (H00006272-M01) (0)

There are no publications for Sortilin Antibody (H00006272-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sortilin Antibody (H00006272-M01) (0)

There are no reviews for Sortilin Antibody (H00006272-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sortilin Antibody (H00006272-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Sortilin Antibody (H00006272-M01)

Discover related pathways, diseases and genes to Sortilin Antibody (H00006272-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sortilin Antibody (H00006272-M01)

Discover more about diseases related to Sortilin Antibody (H00006272-M01).
 

Pathways for Sortilin Antibody (H00006272-M01)

View related products by pathway.

PTMs for Sortilin Antibody (H00006272-M01)

Learn more about PTMs related to Sortilin Antibody (H00006272-M01).
 

Research Areas for Sortilin Antibody (H00006272-M01)

Find related products by research area.

Blogs on Sortilin

There are no specific blogs for Sortilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sortilin Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SORT1
Entrez
OMIM
Uniprot