Sorbitol Dehydrogenase Antibody


Western Blot: Sorbitol Dehydrogenase Antibody [NBP1-74088] - Hela Cell Lysate, Titration: 1 ug/ml, and Gel concentration: 12%
Immunohistochemistry: Sorbitol Dehydrogenase Antibody [NBP1-74088] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 more

Product Details

Product Discontinued
View other related Sorbitol Dehydrogenase Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Sorbitol Dehydrogenase Antibody Summary

Synthetic peptides corresponding to the N terminal of SORD. Immunizing peptide sequence ASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SORD and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Sorbitol Dehydrogenase Antibody

  • EC 1.1.1
  • EC
  • L-iditol 2-dehydrogenase
  • sorbitol dehydrogenase
  • SORD1


Sorbitol dehydrogenase (SORD; EC catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Sorbitol Dehydrogenase Antibody (NBP1-74088) (0)

There are no publications for Sorbitol Dehydrogenase Antibody (NBP1-74088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sorbitol Dehydrogenase Antibody (NBP1-74088) (0)

There are no reviews for Sorbitol Dehydrogenase Antibody (NBP1-74088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sorbitol Dehydrogenase Antibody (NBP1-74088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Sorbitol Dehydrogenase Products

Bioinformatics Tool for Sorbitol Dehydrogenase Antibody (NBP1-74088)

Discover related pathways, diseases and genes to Sorbitol Dehydrogenase Antibody (NBP1-74088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sorbitol Dehydrogenase Antibody (NBP1-74088)

Discover more about diseases related to Sorbitol Dehydrogenase Antibody (NBP1-74088).

Pathways for Sorbitol Dehydrogenase Antibody (NBP1-74088)

View related products by pathway.

PTMs for Sorbitol Dehydrogenase Antibody (NBP1-74088)

Learn more about PTMs related to Sorbitol Dehydrogenase Antibody (NBP1-74088).

Research Areas for Sorbitol Dehydrogenase Antibody (NBP1-74088)

Find related products by research area.

Blogs on Sorbitol Dehydrogenase

There are no specific blogs for Sorbitol Dehydrogenase, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Sorbitol Dehydrogenase Antibody and receive a gift card or discount.


Gene Symbol SORD