Recombinant Human Somatostatin R2/SSTR2 Protein (H00006752-G01)

Images

 
There are currently no images for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Recombinant Human Somatostatin R2/SSTR2 Protein Summary

Description
Somatostatin R2/SSTR2 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Protein/Peptide Type
Recombinant Protein
Gene
SSTR2

Applications/Dilutions

Application Notes
In Vitro Wheat Germ System + Liposome Technology offers significant advantages over commonly used protein expression platforms:

Higher Yield
Greater Stability
High Expression Success Rate
Native Protein Conformation

This protein has not yet been tested for use in functional studies and/or compound screening.
All experiments requiring biological activity of the protein will not be backed by the Novus Guarantee or be eligible for the Innovator's Reward™ and must be undertaken at the customer's own risk.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Somatostatin R2/SSTR2 Protein

  • Smstr2
  • Somatostatin R2
  • somatostatin receptor 2
  • somatostatin receptor type 2
  • SomatostatinR2
  • SRIF-1
  • SS2R
  • SS-2-R
  • SS2-R
  • SST2
  • SSTR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-56498
Species: Hu
Applications: WB, IHC, IHC-P
NB300-120
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-74538
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NB100-74539
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Somatostatin R2/SSTR2 Products

Related Products by Gene

Bioinformatics Tool for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover related pathways, diseases and genes to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover more about diseases related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Pathways for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

View related products by pathway.

PTMs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Learn more about PTMs related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Research Areas for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Find related products by research area.

Blogs on Somatostatin R2/SSTR2

There are no specific blogs for Somatostatin R2/SSTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533
POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Somatostatin R2/SSTR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSTR2
Entrez