Somatostatin R2/SSTR2 Recombinant Protein

Images

 
There are currently no images for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary

Order Details

Somatostatin R2/SSTR2 Recombinant Protein Summary

Description
Somatostatin R2/SSTR2 (Human) Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Gene
SSTR2

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
No Preservative

Applications/Dilutions

Application Notes
In Vitro Wheat Germ System + Liposome Technology offers significant advantages over commonly used protein expression platforms:

Higher Yield
Greater Stability
High Expression Success Rate
Native Protein Conformation

This protein has not yet been tested for use in functional studies and/or compound screening.
All experiments requiring biological activity of the protein will not be backed by the Novus Guarantee or be eligible for the Innovator's Reward™ and must be undertaken at the customer's own risk.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Somatostatin R2/SSTR2 Recombinant Protein

  • Smstr2
  • Somatostatin R2/SSTR2
  • somatostatin receptor 2
  • somatostatin receptor type 2
  • SomatostatinR2
  • SRIF-1
  • SS2R
  • SS-2-R
  • SS2-R
  • SST2
  • SSTR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87022
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56498
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34203
Species: Hu
Applications: IHC, IHC-P
NBP2-37266
Species: Hu, Rt
Applications: WB, ELISA, Flow
NBP1-90927
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74539
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00006752-G01
Species: Hu

Publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Somatostatin R2/SSTR2 Products

Related Products by Gene

Bioinformatics Tool for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover related pathways, diseases and genes to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover more about diseases related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Pathways for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

View related products by pathway.

PTMs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Learn more about PTMs related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Research Areas for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Find related products by research area.

Blogs on Somatostatin R2/SSTR2

There are no specific blogs for Somatostatin R2/SSTR2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SSTR2
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00006752-G01 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533
POMC Antibody
NB100-1533
POMC Antibody
NB100-1533