Recombinant Human Somatostatin R2/SSTR2 Protein

Images

 
There are currently no images for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Func, AP

Order Details

Recombinant Human Somatostatin R2/SSTR2 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (NP_001041.1) for Human Somatostatin R2/SSTR2

Source: Wheat Germ

Amino Acid Sequence: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SSTR2
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
41.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Somatostatin R2/SSTR2 Protein

  • Smstr2
  • Somatostatin R2
  • somatostatin receptor 2
  • somatostatin receptor type 2
  • SomatostatinR2
  • SRIF-1
  • SS2R
  • SS-2-R
  • SS2-R
  • SST2
  • SSTR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NB100-56498
Species: Hu
Applications: WB, IHC, IHC-P
NB300-120
Species: Hu, Mu, Rt
Applications: WB, IP
NBP2-37266
Species: Hu, Rt
Applications: WB, ELISA, Flow, CyTOF-ready
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NB100-74539
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00006752-G01
Species: Hu
Applications: Func, AP

Publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no publications for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no reviews for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Somatostatin R2/SSTR2 Products

Bioinformatics Tool for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover related pathways, diseases and genes to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Discover more about diseases related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Pathways for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

View related products by pathway.

PTMs for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Learn more about PTMs related to Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01).
 

Research Areas for Somatostatin R2/SSTR2 Recombinant Protein (H00006752-G01)

Find related products by research area.

Blogs on Somatostatin R2/SSTR2

There are no specific blogs for Somatostatin R2/SSTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Somatostatin R2/SSTR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SSTR2
Entrez