Recombinant Human SOD2/Mn-SOD Protein

Images

 

Product Details

Summary
Product Discontinued
View other related SOD2/Mn-SOD Peptides and Proteins

Order Details


    • Catalog Number
      H00006648-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human SOD2/Mn-SOD Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human SOD2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLSRAVCGTSRQLPPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SOD2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SOD2/Mn-SOD Protein

  • EC 1.15.1.1
  • indophenoloxidase B
  • IPOB
  • IPO-B
  • manganese-containing superoxide dismutase
  • mangano-superoxide dismutase
  • Mn SOD
  • Mn superoxide dismutase
  • MnSOD
  • MVCD6
  • SOD, Mitochodrial
  • SOD2
  • superoxide dismutase [Mn], mitochondrial
  • superoxide dismutase 2, mitochondrial

Background

SOD2 - superoxide dismutase 2, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01) (0)

There are no publications for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01) (0)

There are no reviews for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SOD2/Mn-SOD Products

Bioinformatics Tool for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01)

Discover related pathways, diseases and genes to SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01)

Discover more about diseases related to SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01).
 

Pathways for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01)

View related products by pathway.

PTMs for SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01)

Learn more about PTMs related to SOD2/Mn-SOD Partial Recombinant Protein (H00006648-Q01).

Blogs on SOD2/Mn-SOD

There are no specific blogs for SOD2/Mn-SOD, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SOD2/Mn-SOD Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SOD2
Entrez