SOCS-3 Antibody (1E4.) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SOCS-3 Primary Antibodies

Order Details


    • Catalog Number
      H00009021-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SOCS-3 Antibody (1E4.) [PerCP] Summary

Immunogen
SOCS3 (AAH60858, 1 a.a. - 225 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Specificity
SOCS3 (1E4)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOCS3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOCS-3 Antibody (1E4.) [PerCP]

  • ATOD4
  • CIS3
  • CIS3CIS-3
  • Cish3
  • cytokine-induced SH2 protein 3
  • Cytokine-inducible SH2 protein 3
  • SOCS3
  • SOCS-3
  • SOCS-3STAT-induced STAT inhibitor 3
  • SSI-3
  • SSI-3ATOD4
  • SSI3MGC71791
  • suppressor of cytokine signaling 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56637
Species: Hu, Mu
Applications: WB
AF2988
Species: Mu, Rt
Applications: WB
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF4979
Species: Hu
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow

Publications for SOCS-3 Antibody (H00009021-M02PCP) (0)

There are no publications for SOCS-3 Antibody (H00009021-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOCS-3 Antibody (H00009021-M02PCP) (0)

There are no reviews for SOCS-3 Antibody (H00009021-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOCS-3 Antibody (H00009021-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOCS-3 Products

Bioinformatics Tool for SOCS-3 Antibody (H00009021-M02PCP)

Discover related pathways, diseases and genes to SOCS-3 Antibody (H00009021-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOCS-3 Antibody (H00009021-M02PCP)

Discover more about diseases related to SOCS-3 Antibody (H00009021-M02PCP).
 

Pathways for SOCS-3 Antibody (H00009021-M02PCP)

View related products by pathway.

PTMs for SOCS-3 Antibody (H00009021-M02PCP)

Learn more about PTMs related to SOCS-3 Antibody (H00009021-M02PCP).
 

Research Areas for SOCS-3 Antibody (H00009021-M02PCP)

Find related products by research area.

Blogs on SOCS-3

There are no specific blogs for SOCS-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOCS-3 Antibody (1E4.) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SOCS3
Entrez