SNX25 Antibody (NBP1-80784)

Images

 
Immunohistochemistry-Paraffin: SNX25 Antibody [NBP1-80784] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNX25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:APPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
SNX25 Recombinant Protein Antigen (NBP1-80784PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNX25 Antibody

  • sorting nexin 25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-88836
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
AF4695
Species: Hu
Applications: WB, IHC, ICC
NBP1-85361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
NBP2-30999
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-38288
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86887
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SNX25 Antibody (NBP1-80784) (0)

There are no publications for SNX25 Antibody (NBP1-80784).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNX25 Antibody (NBP1-80784) (0)

There are no reviews for SNX25 Antibody (NBP1-80784). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SNX25 Antibody (NBP1-80784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNX25 Antibody Products

Related Products by Gene

Bioinformatics Tool for SNX25 Antibody (NBP1-80784)

Discover related pathways, diseases and genes to SNX25 Antibody (NBP1-80784). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNX25 Antibody (NBP1-80784)

Discover more about diseases related to SNX25 Antibody (NBP1-80784).
 

Pathways for SNX25 Antibody (NBP1-80784)

View related products by pathway.

PTMs for SNX25 Antibody (NBP1-80784)

Learn more about PTMs related to SNX25 Antibody (NBP1-80784).
 

Research Areas for SNX25 Antibody (NBP1-80784)

Find related products by research area.

Blogs on SNX25

There are no specific blogs for SNX25, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNX25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX25

Customers Who Bought This Also Bought