SNURPORTIN1 Antibody (2B2-1B4) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related SNURPORTIN1 Primary Antibodies

Order Details


    • Catalog Number
      H00010073-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SNURPORTIN1 Antibody (2B2-1B4) [PE] Summary

Immunogen
RNUT1 (AAH04203, 1 a.a. ~ 361 a.a) full length recombinant protein with GST tag.MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSE RRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDE EMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPV GKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKD YTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHS KLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDV
Specificity
RNUT1 - RNA, U transporter 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNUPN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNURPORTIN1 Antibody (2B2-1B4) [PE]

  • KPNBL
  • RNA U transporter 1
  • RNA, U transporter 1
  • RNUT1
  • snurportin 1
  • Snurportin1
  • SNURPORTIN-1
  • SPN1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB3196
Species: Hu
Applications: WB, IHC
NB100-2582
Species: Hu, Mu, Ch
Applications: WB, ChIP, IHC, IHC-P, IP
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-22268
Species: Hu, Mu
Applications: WB, IP
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-47489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6465
Species: Hu, Rt
Applications: WB, ICC
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-81134
Species: Hu
Applications: IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010073-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SNURPORTIN1 Antibody (H00010073-M01PE) (0)

There are no publications for SNURPORTIN1 Antibody (H00010073-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNURPORTIN1 Antibody (H00010073-M01PE) (0)

There are no reviews for SNURPORTIN1 Antibody (H00010073-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNURPORTIN1 Antibody (H00010073-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNURPORTIN1 Products

Bioinformatics Tool for SNURPORTIN1 Antibody (H00010073-M01PE)

Discover related pathways, diseases and genes to SNURPORTIN1 Antibody (H00010073-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNURPORTIN1 Antibody (H00010073-M01PE)

Discover more about diseases related to SNURPORTIN1 Antibody (H00010073-M01PE).
 

Pathways for SNURPORTIN1 Antibody (H00010073-M01PE)

View related products by pathway.

PTMs for SNURPORTIN1 Antibody (H00010073-M01PE)

Learn more about PTMs related to SNURPORTIN1 Antibody (H00010073-M01PE).

Blogs on SNURPORTIN1

There are no specific blogs for SNURPORTIN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNURPORTIN1 Antibody (2B2-1B4) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol SNUPN