SNF5 Antibody (3F11)


Western Blot: SNF5 Antibody (3F11) [H00006598-M11] - Analysis of SMARCB1 expression in transfected 293T cell line by SMARCB1 monoclonal antibody (M11), clone 3F11. Lane 1: SMARCB1 transfected lysatE (44.1 KDa). Lane 2: more

Product Details

Product Discontinued
View other related SNF5 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SNF5 Antibody (3F11) Summary

SMARCB1 (NP_002922, 123 a.a. - 202 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
SMARCB1 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (3F11)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNF5 Antibody (3F11)

  • BAF47
  • BAF47hSNF5
  • BRG1-associated factor 47
  • hSNFS
  • Ini1
  • Integrase interactor 1 protein
  • malignant rhabdoid tumor suppressor
  • RDTSNF5 homolog
  • Sfh1p
  • SNF5
  • SNF5L1
  • Snr1
  • subfamily b, member 1
  • sucrose nonfermenting, yeast, homolog-like 1
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1


The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: WB

Publications for SNF5 Antibody (H00006598-M11) (0)

There are no publications for SNF5 Antibody (H00006598-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNF5 Antibody (H00006598-M11) (0)

There are no reviews for SNF5 Antibody (H00006598-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNF5 Antibody (H00006598-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SNF5 Products

Bioinformatics Tool for SNF5 Antibody (H00006598-M11)

Discover related pathways, diseases and genes to SNF5 Antibody (H00006598-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNF5 Antibody (H00006598-M11)

Discover more about diseases related to SNF5 Antibody (H00006598-M11).

Pathways for SNF5 Antibody (H00006598-M11)

View related products by pathway.

PTMs for SNF5 Antibody (H00006598-M11)

Learn more about PTMs related to SNF5 Antibody (H00006598-M11).

Research Areas for SNF5 Antibody (H00006598-M11)

Find related products by research area.

Blogs on SNF5.

You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a...  Read full blog post.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SNF5 Antibody (3F11) and receive a gift card or discount.


Gene Symbol SMARCB1