Snail Antibody (2G11) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Snail Primary Antibodies

Order Details


    • Catalog Number
      H00006615-M10G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Snail Antibody (2G11) [DyLight 488] Summary

Immunogen
SNAI1 (NP_005976.2, 121 a.a. - 230 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTH
Specificity
SNAI1 - snail homolog 1 (Drosophila) (2G11)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNAI1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Snail Antibody (2G11) [DyLight 488]

  • Protein sna
  • Protein snail homolog 1
  • SLUGH2
  • SNA
  • SNAH
  • SNAHdJ710H13.1
  • SNAI1
  • snail 1 (drosophila homolog), zinc finger protein
  • snail 1 homolog
  • snail 1 zinc finger protein
  • snail 1, zinc finger protein
  • snail homolog 1 (Drosophila)
  • Snail
  • zinc finger protein SNAI1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP2-14344
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF

Publications for Snail Antibody (H00006615-M10G) (0)

There are no publications for Snail Antibody (H00006615-M10G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Snail Antibody (H00006615-M10G) (0)

There are no reviews for Snail Antibody (H00006615-M10G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Snail Antibody (H00006615-M10G). (Showing 1 - 1 of 1 FAQ).

  1. There are many kinds of antibodies you supply against SNAIL. Could you give me your recommendation? Which is the best for the IHC-P experiments the species of my samples to be tested is human.
    • Our SNAIL antibody with catalog # NBP1-19529 has been successfully validated for IHC-P in paraffin-embedded human lung carcinoma tissue and I would highly recommend you to use the same for your samples too. The working dilutions of this antibody for IHC-P ranges from 1:50 - 1:200 and beside IHC, you can use this antibody for Western Blot and Immunofluorescence also.

Secondary Antibodies

 

Isotype Controls

Additional Snail Products

Bioinformatics Tool for Snail Antibody (H00006615-M10G)

Discover related pathways, diseases and genes to Snail Antibody (H00006615-M10G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Snail Antibody (H00006615-M10G)

Discover more about diseases related to Snail Antibody (H00006615-M10G).
 

Pathways for Snail Antibody (H00006615-M10G)

View related products by pathway.

PTMs for Snail Antibody (H00006615-M10G)

Learn more about PTMs related to Snail Antibody (H00006615-M10G).
 

Research Areas for Snail Antibody (H00006615-M10G)

Find related products by research area.

Blogs on Snail.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Understanding the relationship between HIF-1 alpha, Hypoxia and Epithelial-Mesenchymal Transition
Epithelial-mesenchymal transition (EMT) is a natural process by which epithelial cells lose their polarity and intercellular adhesion, and gain the migratory invasive properties of mesenchymal stem cells that can differentiate into a variety of cel...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Snail Antibody (2G11) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAI1
Entrez