SMN2 Antibody (2B11-2A9) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SMN2 Primary Antibodies

Order Details


    • Catalog Number
      H00006607-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SMN2 Antibody (2B11-2A9) [PerCP] Summary

Immunogen
SMN2 (AAH00908, 1 a.a. - 282 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMN2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMN2 Antibody (2B11-2A9) [PerCP]

  • BCD541
  • C-BCD541
  • Component of gems 1
  • FLJ76644
  • gemin 1
  • gemin-1
  • MGC20996
  • MGC5208
  • SMN
  • SMNCSMN1
  • SMNT
  • survival motor neuron protein
  • survival of motor neuron 2, centromeric

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB829
Species: Hu
Applications: WB, IHC
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF1436
Species: Mu
Applications: WB
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-86191
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
NBP2-49399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF

Publications for SMN2 Antibody (H00006607-M01PCP) (0)

There are no publications for SMN2 Antibody (H00006607-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMN2 Antibody (H00006607-M01PCP) (0)

There are no reviews for SMN2 Antibody (H00006607-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMN2 Antibody (H00006607-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMN2 Products

Bioinformatics Tool for SMN2 Antibody (H00006607-M01PCP)

Discover related pathways, diseases and genes to SMN2 Antibody (H00006607-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMN2 Antibody (H00006607-M01PCP)

Discover more about diseases related to SMN2 Antibody (H00006607-M01PCP).
 

Pathways for SMN2 Antibody (H00006607-M01PCP)

View related products by pathway.

PTMs for SMN2 Antibody (H00006607-M01PCP)

Learn more about PTMs related to SMN2 Antibody (H00006607-M01PCP).
 

Research Areas for SMN2 Antibody (H00006607-M01PCP)

Find related products by research area.

Blogs on SMN2

There are no specific blogs for SMN2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMN2 Antibody (2B11-2A9) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SMN2