SMARCD1 Antibody


Western Blot: SMARCD1 Antibody [NBP1-55249] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related SMARCD1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SMARCD1 Antibody Summary

Synthetic peptides corresponding to SMARCD1 The peptide sequence was selected from the middle region of SMARCD1. Peptide sequence RKLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SMARCD1 and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SMARCD1 Antibody

  • BAF60Amammalian chromatin remodeling complex BRG1-associated factor 60A
  • BRG1-associated factor 60A
  • chromatin remodeling complex BAF60A subunit
  • CRACD1
  • Rsc6p
  • subfamily d, member 1
  • SWI/SNF complex 60 kDa subunit A
  • SWI/SNF complex 60 kDa subunit
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 1,60 kDa BRG-1/Brm-associated factor subunit A
  • Swp73-like protein


SMARCD1 is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. It is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein.The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB

Publications for SMARCD1 Antibody (NBP1-55249) (0)

There are no publications for SMARCD1 Antibody (NBP1-55249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCD1 Antibody (NBP1-55249) (0)

There are no reviews for SMARCD1 Antibody (NBP1-55249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMARCD1 Antibody (NBP1-55249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SMARCD1 Products

Bioinformatics Tool for SMARCD1 Antibody (NBP1-55249)

Discover related pathways, diseases and genes to SMARCD1 Antibody (NBP1-55249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD1 Antibody (NBP1-55249)

Discover more about diseases related to SMARCD1 Antibody (NBP1-55249).

Pathways for SMARCD1 Antibody (NBP1-55249)

View related products by pathway.

PTMs for SMARCD1 Antibody (NBP1-55249)

Learn more about PTMs related to SMARCD1 Antibody (NBP1-55249).

Research Areas for SMARCD1 Antibody (NBP1-55249)

Find related products by research area.

Blogs on SMARCD1

There are no specific blogs for SMARCD1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SMARCD1 Antibody and receive a gift card or discount.


Gene Symbol SMARCD1