SMARCC1 Antibody (1R7I6)

Western Blot: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Western blot analysis of lysates from wild type (WT) and SMARCC1 knockout (KO) 293T cells using [KO Validated] SMARCC1 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.

Western Blot: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Western blot analysis of extracts of various cell lines, using SMARCC1 Rabbit mAb (NBP3-16367) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Chromatin Immunoprecipitation: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Chromatin immunoprecipitation analysis of extracts of MCF7 beta-estradiol cells, using SMARCC1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunocytochemistry/ Immunofluorescence: SMARCC1 Antibody (1R7I6) [NBP3-16367] - Immunofluorescence analysis of NIH-3T3 cells using SMARCC1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IP, ChIP
• Clone: 1R7I6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SMARCC1 Antibody (1R7I6) Summary

• Description: Novus Biologicals Rabbit SMARCC1 Antibody (1R7I6) (NBP3-16367) is a recombinant monoclonal antibody validated for use in WB, ICC/IF, IP and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 700-800 of human SMARCC1 (Q92922). AFLASVVDPRVASAAAKAALEEFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEKMEADPDGQQPEKAENKVENE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMARCC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 1:100 - 1:500
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:100 - 1:500
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMARCC1 Antibody (1R7I6)

• BAF155SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily C member 1
• BRG1-associated factor 155
• chromatin remodeling complex BAF155 subunit
• CRACC1
• mammalian chromatin remodeling complex BRG1-associated factor 155
• Rsc8
• SRG3
• subfamily c, member 1
• SWI/SNF complex 155 kDa subunit
• SWI/SNF complex subunit SMARCC1
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin
• SWI3

Background

The SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin (SMARC), also called BRG1-associated factors (BAFs), have been identified as components of the human SWI/SNF-like chromatin-remodeling protein complexes. SMARCC1/BAF155 is part of the BAF complex that associates with SMARCA2/Brm and SMARCA4/Brg. The mouse homolog is Srg3 and has been found to be required for embryogenesis and brain development. SMARCC1 is also identified as SWI/SNF complex 155 kDa subunit, and BRG1-associated factor 155.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMARCC1