SMAD6 Antibody (2A8)

Images

 
Western Blot: SMAD6 Antibody (2A8) [H00004091-M06] - SMAD6 monoclonal antibody (M06), clone 2A8. Western Blot analysis of SMAD6 expression in human lung cancer.

Product Details

Summary
Product Discontinued
View other related SMAD6 Primary Antibodies

Order Details


    • Catalog Number
      H00004091-M06
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SMAD6 Antibody (2A8) Summary

Immunogen
SMAD6 (NP_005576 285 a.a. - 384 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR
Specificity
SMAD6 (2A8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMAD6 Antibody (2A8)

  • hSMAD6
  • HsT17432
  • MAD homolog 6
  • MADH6SMAD, mothers against DPP homolog 6 (Drosophila)
  • MADH7
  • mothers against decapentaplegic homolog 6
  • Mothers against decapentaplegic, drosophila, homolog of, 6
  • Mothers against DPP homolog 6
  • SMAD 6
  • SMAD family member 6MAD, mothers against decapentaplegic homolog 6 (Drosophila)
  • SMAD, mothers against DPP homolog 6
  • Smad6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
355-BM/CF
Species: Hu, Mu, Rt
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF2250
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
AF3025
Species: Hu
Applications: WB, ICC
AF7215
Species: Hu, Mu
Applications: IHC, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC

Publications for SMAD6 Antibody (H00004091-M06) (0)

There are no publications for SMAD6 Antibody (H00004091-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAD6 Antibody (H00004091-M06) (0)

There are no reviews for SMAD6 Antibody (H00004091-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMAD6 Antibody (H00004091-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMAD6 Products

Bioinformatics Tool for SMAD6 Antibody (H00004091-M06)

Discover related pathways, diseases and genes to SMAD6 Antibody (H00004091-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMAD6 Antibody (H00004091-M06)

Discover more about diseases related to SMAD6 Antibody (H00004091-M06).
 

Pathways for SMAD6 Antibody (H00004091-M06)

View related products by pathway.

PTMs for SMAD6 Antibody (H00004091-M06)

Learn more about PTMs related to SMAD6 Antibody (H00004091-M06).

Blogs on SMAD6

There are no specific blogs for SMAD6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMAD6 Antibody (2A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD6
Entrez
OMIM
Uniprot