Smad4 Antibody

Images

 
Western Blot: SMAD4 Antibody [NBP1-69174] - Mouse Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Smad4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69174
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Smad4 Antibody Summary

Immunogen
Synthetic peptides corresponding to Smad4 (MAD homolog 4 (Drosophila)) The peptide sequence was selected from the middle region of Smad4. Peptide sequence YVHDFEGQPSLPTEGHSIQTIQHPPSNRASTETYSAPALLAPAESNATST.
Clonality
Polyclonal
Host
Rabbit
Gene
SMAD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Smad4 and was validated on Western blot.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Smad4 Antibody

  • DPC4
  • DPC4SMAD, mothers against DPP homolog 4 (Drosophila)
  • hSMAD4
  • JIP
  • MAD homolog 4
  • MADH4
  • MADH4mothers against decapentaplegic homolog 4
  • mothers against decapentaplegic homolog 4
  • mothers against decapentaplegic, Drosophila, homolog of, 4
  • SMAD 4
  • SMAD family member 4MAD, mothers against decapentaplegic homolog 4 (Drosophila)
  • SMAD, mothers against DPP homolog 4
  • Smad4

Background

The function of Smad4 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF3025
Species: Hu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2250
Species: Hu
Applications: WB, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Smad4 Antibody (NBP1-69174) (0)

There are no publications for Smad4 Antibody (NBP1-69174).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad4 Antibody (NBP1-69174) (0)

There are no reviews for Smad4 Antibody (NBP1-69174). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad4 Antibody (NBP1-69174) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad4 Products

Bioinformatics Tool for Smad4 Antibody (NBP1-69174)

Discover related pathways, diseases and genes to Smad4 Antibody (NBP1-69174). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad4 Antibody (NBP1-69174)

Discover more about diseases related to Smad4 Antibody (NBP1-69174).
 

Pathways for Smad4 Antibody (NBP1-69174)

View related products by pathway.

PTMs for Smad4 Antibody (NBP1-69174)

Learn more about PTMs related to Smad4 Antibody (NBP1-69174).

Blogs on Smad4

There are no specific blogs for Smad4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD4
Entrez
Uniprot