Smad3 Antibody

Images

 
Western Blot: Smad3 Antibody [H00004088-D01P] - Analysis of SMAD3 expression in transfected 293T cell line by SMAD3 polyclonal antibody.Lane 1: SMAD3 transfected lysate(12.32 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related Smad3 Primary Antibodies

Order Details


    • Catalog Number
      H00004088-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Smad3 Antibody Summary

Immunogen
SMAD3 (, 31 a.a. - 141 a.a.) full-length human protein. ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG
Clonality
Polyclonal
Host
Rabbit
Gene
SMAD3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad3 Antibody

  • DKFZp586N0721
  • DKFZp686J10186
  • hMAD-3
  • hSMAD3
  • HsT17436
  • JV15-2MGC60396
  • MAD homolog 3
  • mad protein homolog
  • MAD, mothers against decapentaplegic homolog 3 (Drosophila)
  • MAD, mothers against decapentaplegic homolog 3
  • mad3
  • MADH3mad homolog JV15-2
  • mothers against decapentaplegic homolog 3
  • Mothers against DPP homolog 3
  • SMA- and MAD-related protein 3
  • SMAD 3
  • SMAD family member 3HSPC193
  • SMAD, mothers against DPP homolog 3 (Drosophila)
  • SMAD, mothers against DPP homolog 3
  • Smad3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF3025
Species: Hu
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Smad3 Antibody (H00004088-D01P) (0)

There are no publications for Smad3 Antibody (H00004088-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad3 Antibody (H00004088-D01P) (0)

There are no reviews for Smad3 Antibody (H00004088-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad3 Antibody (H00004088-D01P). (Showing 1 - 1 of 1 FAQ).

  1. I was wondering if you can recommend any primary polyclonal Smad3 antibody (reactivity: human) for gel supershifts?
    • We do provide a wide range of Smad3 antibodies, but unfortunately none of them have been tested for gel shift assay, so we can't guarantee they will work for an application never tested before.

Secondary Antibodies

 

Isotype Controls

Additional Smad3 Products

Bioinformatics Tool for Smad3 Antibody (H00004088-D01P)

Discover related pathways, diseases and genes to Smad3 Antibody (H00004088-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad3 Antibody (H00004088-D01P)

Discover more about diseases related to Smad3 Antibody (H00004088-D01P).
 

Pathways for Smad3 Antibody (H00004088-D01P)

View related products by pathway.

PTMs for Smad3 Antibody (H00004088-D01P)

Learn more about PTMs related to Smad3 Antibody (H00004088-D01P).
 

Research Areas for Smad3 Antibody (H00004088-D01P)

Find related products by research area.

Blogs on Smad3

There are no specific blogs for Smad3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD3
Entrez