Smad2 Antibody (4D10)

Images

 
Western Blot: Smad2 Antibody (4D10) [H00004087-M01] - SMAD2 monoclonal antibody (M01), clone 4D10 Analysis of SMAD2 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: Smad2 Antibody (4D10) [H00004087-M01] - Analysis of monoclonal antibody to SMAD2 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Smad2 Antibody (4D10) [H00004087-M01] - Analysis of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.
Sandwich ELISA: Smad2 Antibody (4D10) [H00004087-M01] - Detection limit for recombinant GST tagged SMAD2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smad2 Antibody (4D10) Summary

Immunogen
SMAD2 (AAH25699, 181 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
Specificity
SMAD2 - SMAD, mothers against DPP homolog 2 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad2 Antibody (4D10)

  • hMAD-2
  • hSMAD2
  • JV18
  • JV18-1
  • JV18-1SMAD, mothers against DPP homolog 2 (Drosophila)
  • MAD homolog 2
  • Mad protein homolog
  • Mad, mothers against decapentaplegic homolog 2
  • MADH2
  • MADH2MGC34440
  • MADR2
  • MADR2MGC22139
  • Mad-related protein 2
  • mother against DPP homolog 2
  • mothers against decapentaplegic homolog 2
  • Mothers against DPP homolog 2
  • Sma- and Mad-related protein 2
  • SMAD 2
  • SMAD family member 2MAD, mothers against decapentaplegic homolog 2 (Drosophila)
  • SMAD, mothers against DPP homolog 2
  • Smad2
  • Smox

Background

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF2097
Species: Hu
Applications: WB, ChIP, ICC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF3025
Species: Hu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC

Publications for Smad2 Antibody (H00004087-M01) (0)

There are no publications for Smad2 Antibody (H00004087-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad2 Antibody (H00004087-M01) (0)

There are no reviews for Smad2 Antibody (H00004087-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Smad2 Antibody (H00004087-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad2 Products

Bioinformatics Tool for Smad2 Antibody (H00004087-M01)

Discover related pathways, diseases and genes to Smad2 Antibody (H00004087-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad2 Antibody (H00004087-M01)

Discover more about diseases related to Smad2 Antibody (H00004087-M01).
 

Pathways for Smad2 Antibody (H00004087-M01)

View related products by pathway.

PTMs for Smad2 Antibody (H00004087-M01)

Learn more about PTMs related to Smad2 Antibody (H00004087-M01).
 

Research Areas for Smad2 Antibody (H00004087-M01)

Find related products by research area.

Blogs on Smad2

There are no specific blogs for Smad2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad2 Antibody (4D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD2
Entrez
OMIM
Uniprot