SLURP1 Antibody

Images

 
Western Blot: SLURP1 Antibody [NBP2-13351] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: esophagus
Immunohistochemistry-Paraffin: SLURP1 Antibody [NBP2-13351] - Staining of human skin shows strong cytoplasmic positivity in a subset of keratinocytes.

Product Details

Summary
Reactivity Hu, ChHaSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLURP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCV ATDPDSIGAAHLIFCCFRDLCN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLURP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLURP1 Protein (NBP2-13351PEP)
Publications
Read Publication using
NBP2-13351 in the following applications:

  • WB
    1 publication

Reactivity Notes

Chinese Hamster reactivity reported in scientific literature (PMID: 27034464)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLURP1 Antibody

  • ANUPARS(component B)-81/S
  • ARS Component B
  • ArsB
  • ARSlymphocyte antigen 6-like secreted
  • LY6LS
  • MDMsecreted Ly-6/uPAR-related protein 1
  • neoplastic urinary protein
  • secreted LY6/PLAUR domain containing 1
  • secreted Ly6/uPAR related protein 1
  • SLURP1
  • SLURP-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2485
Species: Hu
Applications: WB, IHC, IP
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22522
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP1-88498
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for SLURP1 Antibody (NBP2-13351)(1)

We have publications tested in 1 confirmed species: Chinese Hamster.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Chinese Hamster
(1)
All Species

Reviews for SLURP1 Antibody (NBP2-13351) (0)

There are no reviews for SLURP1 Antibody (NBP2-13351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLURP1 Antibody (NBP2-13351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLURP1 Products

Bioinformatics Tool for SLURP1 Antibody (NBP2-13351)

Discover related pathways, diseases and genes to SLURP1 Antibody (NBP2-13351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLURP1 Antibody (NBP2-13351)

Discover more about diseases related to SLURP1 Antibody (NBP2-13351).
 

Pathways for SLURP1 Antibody (NBP2-13351)

View related products by pathway.

PTMs for SLURP1 Antibody (NBP2-13351)

Learn more about PTMs related to SLURP1 Antibody (NBP2-13351).
 

Research Areas for SLURP1 Antibody (NBP2-13351)

Find related products by research area.

Blogs on SLURP1

There are no specific blogs for SLURP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLURP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLURP1
Entrez