Slug Antibody (3C12) [Alexa Fluor® 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Slug Primary Antibodies

Order Details


    • Catalog Number
      H00006591-M05AF405
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Slug Antibody (3C12) [Alexa Fluor® 405] Summary

Immunogen
SNAI2 (NP_003059, 97 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Specificity
SNAI2 (3C12)
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNAI2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. This product is produced by and distributed for Abnova, a company based in Taiwan.This product is provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com.

Alternate Names for Slug Antibody (3C12) [Alexa Fluor® 405]

  • MGC10182
  • Neural crest transcription factor Slug
  • Protein snail homolog 2
  • slug homolog, zinc finger protein (chicken)
  • Slug
  • SLUGH
  • SLUGH1
  • SLUGzinc finger protein
  • SNAI2
  • snail 2
  • snail homolog 2 (Drosophila)
  • SNAIL2
  • WS2D
  • zinc finger protein SNAI2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27184
Species: Hu, Mu, Ca, Eq
Applications: WB, ICC/IF
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF

Publications for Slug Antibody (H00006591-M05AF405) (0)

There are no publications for Slug Antibody (H00006591-M05AF405).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slug Antibody (H00006591-M05AF405) (0)

There are no reviews for Slug Antibody (H00006591-M05AF405). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Slug Antibody (H00006591-M05AF405) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Slug Products

Bioinformatics Tool for Slug Antibody (H00006591-M05AF405)

Discover related pathways, diseases and genes to Slug Antibody (H00006591-M05AF405). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slug Antibody (H00006591-M05AF405)

Discover more about diseases related to Slug Antibody (H00006591-M05AF405).
 

Pathways for Slug Antibody (H00006591-M05AF405)

View related products by pathway.

PTMs for Slug Antibody (H00006591-M05AF405)

Learn more about PTMs related to Slug Antibody (H00006591-M05AF405).
 

Research Areas for Slug Antibody (H00006591-M05AF405)

Find related products by research area.

Blogs on Slug.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slug Antibody (3C12) [Alexa Fluor® 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAI2
Entrez