SLK Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

SLK Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLK
  
  

  Source: E.coli

  Amino Acid Sequence: KEPEVTVVSQPTEPQPVLIPSININSDSGENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSK

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SLK
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25147It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLK Recombinant Protein Antigen

• bA16H23.1
• CTCL tumor antigen se20-9
• EC 2.7.11
• EC 2.7.11.1
• hSLK
• KIAA0204LOSK
• Long Ste20-like Kinase
• se20-9
• Serine/threonine-protein kinase 2
• SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase (yeast)
• SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrosenonfermenting like kinase
• SNF1 sucrose nonfermenting like kinase
• STE20-like kinaseSTE20-like kinase (yeast)
• STE20-like serine/threonine-protein kinase
• STE20-related kinase
• Ste20-related serine/threonine kinase
• STE20-related serine/threonine-protein kinase
• STK2MGC133067

Background

The product of this gene belongs to a subfamily of calcium binding proteins, which share similarity to calmodulin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Expression of this gene was only detected in retina and brain. Study of the mouse homolog demonstrated that groups of cells expressing this protein are located in the center or inner border of the inner unclear layer of retina. Three alternatively spliced variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLK