SLITRK1 Antibody


Western Blot: SLITRK1 Antibody [NBP1-69442] - This Anti-SLITRK1 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related SLITRK1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLITRK1 Antibody Summary

Synthetic peptides corresponding to SLITRK1(SLIT and NTRK-like family, member 1) The peptide sequence was selected from the N terminal of SLITRK1. Peptide sequence CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLITRK1 and was validated on Western blot.
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLITRK1 Antibody

  • FLJ54428
  • KIAA1910KIAA0918
  • leucine rich repeat containing 12
  • Leucine-rich repeat-containing protein 12
  • LRRC12
  • RP11-395N17.1
  • SLIT and NTRK-like family, member 1
  • SLIT and NTRK-like protein 1
  • slit and trk like gene 1
  • TTM


Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins. Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors. SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity.Members of the SLITRK family, such as SLITRK1, are integral membrane proteins with 2 N-terminal leucine-rich repeat (LRR) domains similar to those of SLIT proteins (see SLIT1; MIM 603742). Most SLITRKs, but not SLITRK1, also have C-terminal regions that share homology with neurotrophin receptors (see NTRK1; MIM 191315). SLITRKs are expressed predominantly in neural tissues and have neurite-modulating activity (Aruga et al., 2003 [PubMed 14557068]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB

Publications for SLITRK1 Antibody (NBP1-69442) (0)

There are no publications for SLITRK1 Antibody (NBP1-69442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLITRK1 Antibody (NBP1-69442) (0)

There are no reviews for SLITRK1 Antibody (NBP1-69442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLITRK1 Antibody (NBP1-69442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLITRK1 Products

Bioinformatics Tool for SLITRK1 Antibody (NBP1-69442)

Discover related pathways, diseases and genes to SLITRK1 Antibody (NBP1-69442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLITRK1 Antibody (NBP1-69442)

Discover more about diseases related to SLITRK1 Antibody (NBP1-69442).

Pathways for SLITRK1 Antibody (NBP1-69442)

View related products by pathway.

PTMs for SLITRK1 Antibody (NBP1-69442)

Learn more about PTMs related to SLITRK1 Antibody (NBP1-69442).

Research Areas for SLITRK1 Antibody (NBP1-69442)

Find related products by research area.

Blogs on SLITRK1

There are no specific blogs for SLITRK1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLITRK1 Antibody and receive a gift card or discount.


Gene Symbol SLITRK1