SLC9A5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC9A5 Antibody [NBP1-80997] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SLC9A5 Antibody [NBP1-80997] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC9A5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC9A5 Protein (NBP1-80997PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC9A5 Antibody

  • Na(+)/H(+) exchanger 5
  • NHE-5
  • NHE5solute carrier family 9 (sodium/hydrogen exchanger), isoform 5
  • sodium/hydrogen exchanger 5
  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), member 5
  • Solute carrier family 9 member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38683
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP2-38236
Species: Hu
Applications: IHC, IHC-P, WB
NB100-2450
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-38280
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023446-A01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP1-28875
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00612
Species: Hu
Applications: Flow, IHC, IHC-P, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-67165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45688
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4339
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-84581
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA

Publications for SLC9A5 Antibody (NBP1-80997) (0)

There are no publications for SLC9A5 Antibody (NBP1-80997).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A5 Antibody (NBP1-80997) (0)

There are no reviews for SLC9A5 Antibody (NBP1-80997). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC9A5 Antibody (NBP1-80997) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC9A5 Products

Bioinformatics Tool for SLC9A5 Antibody (NBP1-80997)

Discover related pathways, diseases and genes to SLC9A5 Antibody (NBP1-80997). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SLC9A5 Antibody (NBP1-80997)

View related products by pathway.

Blogs on SLC9A5

There are no specific blogs for SLC9A5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC9A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A5
Entrez