SLC9A5 Antibody

Images

 
Western Blot: SLC9A5 Antibody [NBP1-74062] - Titration: 1.0 ug/ml Positive Control: Mouse Brain.

Product Details

Summary
Product Discontinued
View other related SLC9A5 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74062
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC9A5 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Slc9a5. Immunizing peptide sequence SFAFPPSLAKAGRSRSESSADIPQQELQPLMGHKDHTHLSPGTANSHWCI.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC9A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc9a5 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC9A5 Antibody

  • Na(+)/H(+) exchanger 5
  • NHE-5
  • NHE5solute carrier family 9 (sodium/hydrogen exchanger), isoform 5
  • sodium/hydrogen exchanger 5
  • solute carrier family 9 (sodium/hydrogen exchanger)
  • solute carrier family 9 (sodium/hydrogen exchanger), member 5
  • Solute carrier family 9 member 5

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-82576
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-38280
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023446-A01
Species: Hu, Mu
Applications: WB, ELISA
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-108
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-45688
Species: Hu
Applications: WB, IHC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
AF4339
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt

Publications for SLC9A5 Antibody (NBP1-74062) (0)

There are no publications for SLC9A5 Antibody (NBP1-74062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC9A5 Antibody (NBP1-74062) (0)

There are no reviews for SLC9A5 Antibody (NBP1-74062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC9A5 Antibody (NBP1-74062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC9A5 Products

Bioinformatics Tool for SLC9A5 Antibody (NBP1-74062)

Discover related pathways, diseases and genes to SLC9A5 Antibody (NBP1-74062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SLC9A5 Antibody (NBP1-74062)

View related products by pathway.

Blogs on SLC9A5

There are no specific blogs for SLC9A5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC9A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A5
Uniprot