SLC6A18 Antibody


Western Blot: SLC6A18 Antibody [NBP1-59903] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-59903] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC6A18 Antibody Summary

Synthetic peptides corresponding to SLC6A18(solute carrier family 6, member 18) The peptide sequence was selected from the middle region of SLC6A18. Peptide sequence MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP. The peptide sequence for this immunogen was taken from within the described region.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLC6A18 and was validated on Western Blot and immunohistochemistry-paraffin

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC6A18 Antibody

  • FLJ31236
  • Sodium- and chloride-dependent transporter XTRP2
  • sodium channel-like protein
  • sodium-dependent neutral amino acid transporter B(0)AT3
  • solute carrier family 6 (neurotransmitter transporter), member 18
  • Solute carrier family 6 member 18
  • solute carrier family 6, member 18
  • System B(0) neutral amino acid transporter AT3
  • XTRP2


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, Simple Western, Flow, IHC, IP, Block
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Single-Cell Western
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for SLC6A18 Antibody (NBP1-59903) (0)

There are no publications for SLC6A18 Antibody (NBP1-59903).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A18 Antibody (NBP1-59903) (0)

There are no reviews for SLC6A18 Antibody (NBP1-59903). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A18 Antibody (NBP1-59903) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC6A18 Products

Bioinformatics Tool for SLC6A18 Antibody (NBP1-59903)

Discover related pathways, diseases and genes to SLC6A18 Antibody (NBP1-59903). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A18 Antibody (NBP1-59903)

Discover more about diseases related to SLC6A18 Antibody (NBP1-59903).

Pathways for SLC6A18 Antibody (NBP1-59903)

View related products by pathway.

PTMs for SLC6A18 Antibody (NBP1-59903)

Learn more about PTMs related to SLC6A18 Antibody (NBP1-59903).

Blogs on SLC6A18

There are no specific blogs for SLC6A18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC6A18 Antibody and receive a gift card or discount.


Gene Symbol SLC6A18