SLC6A17 Antibody

Images

 
Western Blot: SLC6A17 Antibody [NBP1-86123] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SLC6A17 Antibody [NBP1-86123] - Staining of human cell line SiHa shows positivity in nucleus, nucleoli & the Golgi apparatus.
Immunohistochemistry-Paraffin: SLC6A17 Antibody [NBP1-86123] - Staining of human heart muscle shows strong nuclear and cytoplasmic positivity in myocytes.
Western Blot: SLC6A17 Antibody [NBP1-86123] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Product Discontinued
View other related SLC6A17 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86123
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC6A17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC6A17 Antibody

  • NTT4
  • orphan sodium- and chloride-dependent neurotransmitter transporter NTT4
  • Sodium-dependent neurotransmitter transporter NTT4
  • solute carrier family 6 (neurotransmitter transporter), member 17
  • Solute carrier family 6 member 17
  • solute carrier family 6, member 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83867
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77368
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-69750
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
640-A3
Species: Mu
NBP2-43538
Species: Hu
Applications: WB, IHC, IHC-P
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01652
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP

Publications for SLC6A17 Antibody (NBP1-86123) (0)

There are no publications for SLC6A17 Antibody (NBP1-86123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A17 Antibody (NBP1-86123) (0)

There are no reviews for SLC6A17 Antibody (NBP1-86123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC6A17 Antibody (NBP1-86123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A17 Products

Bioinformatics Tool for SLC6A17 Antibody (NBP1-86123)

Discover related pathways, diseases and genes to SLC6A17 Antibody (NBP1-86123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A17 Antibody (NBP1-86123)

Discover more about diseases related to SLC6A17 Antibody (NBP1-86123).
 

Pathways for SLC6A17 Antibody (NBP1-86123)

View related products by pathway.

Blogs on SLC6A17

There are no specific blogs for SLC6A17, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A17