SLC45A1 Antibody

Images

 
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Staining of kidney.
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Staining of lung cancer.

Product Details

Summary
Product Discontinued
View other related SLC45A1 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-31563
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC45A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FSSPISPPSPLTPKYGSFISRDSSLTGISEFASSFGTANIDSVLIDCFTGGHDSYLAIPGSVPRPPISVSFP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC45A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC45A1 Antibody

  • Deleted In Neuroblastoma 5 Protein
  • Deleted In Neuroblastoma 5
  • DNB5
  • DNb-5
  • PAST-A
  • Proton-Associated Sugar Transporter A
  • Solute Carrier Family 45 Member 13
  • Solute Carrier Family 45, Member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1936
Species: Hu
Applications: WB, IP
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00001831-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31563
Species: Hu
Applications: IHC, IHC-P

Publications for SLC45A1 Antibody (NBP2-31563) (0)

There are no publications for SLC45A1 Antibody (NBP2-31563).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC45A1 Antibody (NBP2-31563) (0)

There are no reviews for SLC45A1 Antibody (NBP2-31563). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC45A1 Antibody (NBP2-31563) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC45A1 Products

SLC45A1 NBP2-31563

Bioinformatics Tool for SLC45A1 Antibody (NBP2-31563)

Discover related pathways, diseases and genes to SLC45A1 Antibody (NBP2-31563). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC45A1

There are no specific blogs for SLC45A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC45A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC45A1
Uniprot