SLC44A3 Antibody

Images

 
Western Blot: SLC44A3 Antibody [NBP1-91571] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC44A3 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC44A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SLC44A3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC44A3 Antibody

  • choline transporter-like protein 3
  • member 3
  • MGC45474
  • solute carrier family 44, member 3
  • UNQ558/PRO1115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023446-A01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00057153-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
H00006143-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
AF5507
Species: Hu, Mu
Applications: WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
NBP1-91571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for SLC44A3 Antibody (NBP1-91571) (0)

There are no publications for SLC44A3 Antibody (NBP1-91571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC44A3 Antibody (NBP1-91571) (0)

There are no reviews for SLC44A3 Antibody (NBP1-91571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC44A3 Antibody (NBP1-91571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC44A3 Products

Bioinformatics Tool for SLC44A3 Antibody (NBP1-91571)

Discover related pathways, diseases and genes to SLC44A3 Antibody (NBP1-91571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC44A3

There are no specific blogs for SLC44A3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC44A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC44A3
Uniprot