Home » SLC44A3 » SLC44A3 Antibodies » SLC44A3 Antibody

SLC44A3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: SLC44A3 Antibody [NBP1-91571] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: SLC44A3 Antibody [NBP1-91571] - Hela cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SLC44A3 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human SLC44A3. Peptide sequence MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC44A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against SLC44A3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC44A3 Antibody

  • choline transporter-like protein 3
  • member 3
  • MGC45474
  • solute carrier family 44, member 3
  • UNQ558/PRO1115

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTL1/SLC44A1
Antibody
H00023446-A01
Western Blot: CTL1/SLC44A1 Antibody [H00023446-A01] - Detection against Immunogen (38.21 KDa).
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
CD8 Antibody
(53-6.7)
NBP1-49045
Immunocytochemistry/Immunofluorescence: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/mL and incubated for 3 hours at room temperature.
Immunohistochemistry: CD8 Antibody (53-6.7) [NBP1-49045] - Histopathological analysis of spinal cord in EAE mice. Representative spinal cord sections from wild-type (WT), Asic1-/-, and Asic2-/- mice at 45 days after immunization. Sections of the spinal cord anterior horn were stained with hematoxylin and eosin (E&H) to assess inflammation and immunostained for MCHII, CD4+, CD8+ infiltrating cells. Image collected and cropped by CiteAb from the following publication (https://onlinelibrary.wiley.com/doi/abs/10.1111/ejn.14302), licensed under a CC-BY licence.
Flow Cytometry: CD8 Antibody (53-6.7) [NBP1-49045] - CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.
(2 Reviews)
(16 Publications)
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
SLC44A2 Antibody
(3D11)
H00057153-M01
Immunohistochemistry-Paraffin: SLC44A2 Antibody (3D11) [H00057153-M01] - Analysis of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. Antibody concentration 3 ug/ml.
ELISA: SLC44A2 Antibody (3D11) [H00057153-M01] - Detection limit for recombinant GST tagged SLC44A2 is approximately 0.3ng/ml as a capture antibody.
(5 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
OCT4 Antibody
NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - YM155 significantly reduced tumorsphere formation and inhibited EGFR autophosphorylation and G9a expression. YM155 is reported to suppress cancer stemness; therefore, we used this compound to investigate the cellular mechanism of tumorsphere formation. To compare the cytotoxic capacity of YM155 against tumorsphere formation and parental cell lines, YM155 was applied to HCC827 and A549 cells in the stemness cultured or integrated medium. (F) Moreover, YM155 inhibited EGFR autophosphorylation in A549-derived tumorspheres and reduced Oct4 expression. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0182149) licensed under a CC-BY licence.
Western Blot: OCT4 Antibody [NB100-2379] - WB detection of OCT4 in mouse brain lysate using OCT4 antibody with ECL based detection. The antibody generated a specific band of OCT4 at the expected ~40kDa position.
Flow Cytometry: OCT4 Antibody [NB100-2379] - An intracellular stain was performed on Jurkat with NB100-2379 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
(2 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
RPL19 Antibody
(3H4)
H00006143-M01
Western Blot: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of RPL19 expression in transfected 293T cell line by RPL19 monoclonal antibody (M01), clone 3H4.Lane 1: RPL19 transfected lysate (Predicted MW: 23.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: RPL19 Antibody (3H4) [H00006143-M01] - Immortalised untreated mouse dendritic cells stained with DAPI, Mettl27 and RPL19 in green. Acquisition in confocal imaging. RLP19 primary antibody coupled with Alexa488. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: RPL19 Antibody (3H4) [H00006143-M01] - Analysis of monoclonal antibody to RPL19 on formalin-fixed paraffin-embedded human small Intestine tissue. Antibody concentration 1 ~ 10 ug/ml.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
CHT1 Antibody
(62-2E8)
NB110-74570
Western Blot: CHT1 Antibody (62-2E8) [NB110-74570] - Western Blot Image of anti-CHT1 (62-2E8). Total protein from mouse brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with a 1:500 dilution of anti-CHT1 in 1% milk/TBST. Reactivity was detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry: CHT1 Antibody (62-2E8) [NB110-74570] - Staining of neurons in rat basal forebrain
(3 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
HMGB3/HMG4 Antibody
AF5507
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, 293T human embryonic kidney cell line, and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse HMGB3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5507) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for HMGB3 at approximately 29 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu, Mu
Applications: WB
Histone H1
Antibody (HH1/957)
NBP2-45184
Immunocytochemistry/Immunofluorescence: Histone H1 Antibody (HH1/957) [NBP2-45184] - Confocal Immunofluorescence image of HeLa cells using Green (CF488) and Phalloidin is used to label the membranes.
Immunohistochemistry-Paraffin: Histone H1 Antibody (HH1/957) [NBP2-45184] - Formalin-fixed, paraffin-embedded human Angiosarcoma stained with Histone H1 Antibody (HH1/957).
Immunocytochemistry/Immunofluorescence: Histone H1 Antibody (HH1/957) [NBP2-45184] - Human cell culture cells were fixed with paraformaldehyde, permeabilised and incubated 1 hour at RT with primary antibody. This image was submitted via customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P
OCT2 Antibody
(Oct2/2137)
NBP2-75734
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis (A) Recombinant Protein (B) Daudi cell lysate Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Immunohistochemistry-Paraffin: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Formalin-fixed, paraffin-embedded human Tonsil stained with Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Western Blot: OCT2 Antibody (Oct2/2137) [NBP2-75734] - Analysis Ramos cell lysate using Oct-2 Mouse Monoclonal Antibody (OCT2/2137).
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
OCT1 Antibody
NBP2-21584
Western Blot: OCT1 Antibody [NBP2-21584] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with OCT1 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: OCT1 Antibody [NBP2-21584] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: OCT1 protein stained by OCT1 antibody diluted at 1:500. Red: phalloidin, a cytoskeleton marker, stained by () diluted at 1:200. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: OCT1 Antibody [NBP2-21584] - Rat brain. OCT1 antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Mouse CD3+ T Cell,
Small Column Enrichme ...
MTCC-10-NOV
Mouse CD3+ T Cell, Small Column Enrichment Kit
SLC22A3 Antibody
NBP1-69368
Western Blot: SLC22A3 Antibody [NBP1-69368] - This Anti-SLC22A3 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.5ug/ml.
Immunohistochemistry: SLC22A3 Antibody [NBP1-69368] - Human kidney
Species: Hu
Applications: WB, IHC, IHC-P
SLC22A1 Antibody
(2C5)
NBP1-51684
Western Blot: SLC22A1 Antibody (2C5) [NBP1-51684] - Analysis using SLC22A1 mAb against HEK293 (1) and SLC22A1(AA: 284-347)-hIgGFc transfected HEK293 (2) cell lysate.
Flow Cytometry: SLC22A1 Antibody (2C5) [NBP1-51684] - Analysis of Jurkat cells using SLC22A1 mouse mAb (green) and negative control (purple).
(6 Publications)
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
SLC22A2/OCT2
Antibody
NBP1-89417
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Analysis in human kidney and liver tissues. Corresponding SLC22A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC22A2/OCT2 Antibody [NBP1-89417] - Staining of human endometrium shows no positivity in glandular cells as expected.
(2 Publications)
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
SLC44A3 Antibody
NBP1-91571
SLC44A3 Antibody
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb
Applications: WB

Publications for SLC44A3 Antibody (NBP1-91571) (0)

There are no publications for SLC44A3 Antibody (NBP1-91571).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC44A3 Antibody (NBP1-91571) (0)

There are no reviews for SLC44A3 Antibody (NBP1-91571). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC44A3 Antibody (NBP1-91571) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SLC44A3 Products

Bioinformatics Tool for SLC44A3 Antibody (NBP1-91571)

Discover related pathways, diseases and genes to SLC44A3 Antibody (NBP1-91571). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC44A3

There are no specific blogs for SLC44A3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC44A3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC44A3
Uniprot