SLC29A4 Antibody (6B6)

Images

 
Western Blot: SLC29A4 Antibody (6B6) [H00222962-M03] - Analysis of SLC29A4 expression in PC-12 (Cat # L012V1).
Sandwich ELISA: SLC29A4 Antibody (6B6) [H00222962-M03] - Detection limit for recombinant GST tagged SLC29A4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
6B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SLC29A4 Antibody (6B6) Summary

Immunogen
SLC29A4 (NP_694979, 283 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Specificity
SLC29A4 (6B6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC29A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC29A4 Antibody (6B6)

  • ENT4PMAT
  • equilibrative nucleoside transporter 4
  • FLJ34923
  • hENT4
  • Plasma membrane monoamine transporter
  • solute carrier family 29 (nucleoside transporters), member 4
  • Solute carrier family 29 member 4

Background

This gene is a member of the SLC29 family and encodes a plasma membrane protein with 11 transmembrane helices. This protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternate transcriptional splice variants which encode the same protein have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-02977
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-05546
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P, Single-Cell Western
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-69313
Species: Hu
Applications: WB
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5486
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP2-81829
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NB110-68123
Species: Hu, Mu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84418
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP2-75734
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PA
NBP2-38763
Species: Hu
Applications: IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for SLC29A4 Antibody (H00222962-M03) (0)

There are no publications for SLC29A4 Antibody (H00222962-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC29A4 Antibody (H00222962-M03) (0)

There are no reviews for SLC29A4 Antibody (H00222962-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC29A4 Antibody (H00222962-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC29A4 Products

Bioinformatics Tool for SLC29A4 Antibody (H00222962-M03)

Discover related pathways, diseases and genes to SLC29A4 Antibody (H00222962-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC29A4 Antibody (H00222962-M03)

Discover more about diseases related to SLC29A4 Antibody (H00222962-M03).
 

Pathways for SLC29A4 Antibody (H00222962-M03)

View related products by pathway.

Blogs on SLC29A4

There are no specific blogs for SLC29A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC29A4 Antibody (6B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC29A4
Entrez
OMIM
Uniprot