SLC25A31 Antibody

Images

 
Western Blot: SLC25A31 Antibody [NBP1-74165] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Product Discontinued
View other related SLC25A31 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-74165
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC25A31 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Slc25a31. Immunizing peptide sequence ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV.
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A31
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc25a31 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC25A31 Antibody

  • AAC4DKFZp434N1235
  • adenine nucleotide translocase 4
  • Adenine nucleotide translocator 4
  • ADP
  • ADP/ATP translocase 4
  • ANT 4
  • ANT4DKFZP434N1235
  • ATP carrier protein 4
  • SFEC
  • SFEC35kDa
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31
  • Solute carrier family 25 member 31
  • Sperm flagellar energy carrier protein

Background

Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
H00001876-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBL1-14964
Species: Hu
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for SLC25A31 Antibody (NBP1-74165) (0)

There are no publications for SLC25A31 Antibody (NBP1-74165).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A31 Antibody (NBP1-74165) (0)

There are no reviews for SLC25A31 Antibody (NBP1-74165). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A31 Antibody (NBP1-74165) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A31 Products

Bioinformatics Tool for SLC25A31 Antibody (NBP1-74165)

Discover related pathways, diseases and genes to SLC25A31 Antibody (NBP1-74165). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A31 Antibody (NBP1-74165)

Discover more about diseases related to SLC25A31 Antibody (NBP1-74165).
 

Pathways for SLC25A31 Antibody (NBP1-74165)

View related products by pathway.

PTMs for SLC25A31 Antibody (NBP1-74165)

Learn more about PTMs related to SLC25A31 Antibody (NBP1-74165).

Blogs on SLC25A31

There are no specific blogs for SLC25A31, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A31 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A31
Uniprot