SLC25A20 Antibody (M2) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related SLC25A20 Primary Antibodies

Order Details


    • Catalog Number
      H00000788-M02PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

SLC25A20 Antibody (M2) [PerCP] Summary

Immunogen
SLC25A20 (AAH01689, 1 a.a. - 301 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADQPKPISPLKNLLAGGFGGVCLVFAGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
Specificity
SLC25A20 - solute carrier family 25 (carnitine/acylcarnitine translocase), member 20
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC25A20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC25A20 Antibody (M2) [PerCP]

  • CACCarnitine/acylcarnitine translocase
  • CACTSolute carrier family 25 member 20
  • mitochondrial carnitine/acylcarnitine carrier protein
  • solute carrier family 25 (carnitine/acylcarnitine translocase), member 20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
H00000788-M02PCP
Species: Hu
Applications: ELISA, ICC/IF

Publications for SLC25A20 Antibody (H00000788-M02PCP) (0)

There are no publications for SLC25A20 Antibody (H00000788-M02PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC25A20 Antibody (H00000788-M02PCP) (0)

There are no reviews for SLC25A20 Antibody (H00000788-M02PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC25A20 Antibody (H00000788-M02PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC25A20 Products

Bioinformatics Tool for SLC25A20 Antibody (H00000788-M02PCP)

Discover related pathways, diseases and genes to SLC25A20 Antibody (H00000788-M02PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A20 Antibody (H00000788-M02PCP)

Discover more about diseases related to SLC25A20 Antibody (H00000788-M02PCP).
 

Pathways for SLC25A20 Antibody (H00000788-M02PCP)

View related products by pathway.

PTMs for SLC25A20 Antibody (H00000788-M02PCP)

Learn more about PTMs related to SLC25A20 Antibody (H00000788-M02PCP).

Blogs on SLC25A20

There are no specific blogs for SLC25A20, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A20 Antibody (M2) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A20