SLC24A3 Recombinant Protein Antigen

Images

 
There are currently no images for SLC24A3 Protein (NBP2-31010PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC24A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC24A3.

Source: E.coli

Amino Acid Sequence: KELDLMDLVGEDRKWMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC24A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-31010.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SLC24A3 Recombinant Protein Antigen

  • sodium/potassium/calcium exchanger 3
  • NCKX3
  • solute carrier family 24 (sodium/potassium/calcium exchanger), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-92397
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59897
Species: Hu
Applications: WB
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NB300-600
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-2869
Species: Hu, Mu, Rt, Po, Bv, Ca, GP, I, Kg, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-48980
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00201780-P01
Species: Hu
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-31558
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33063
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
MAB3650
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-31010PEP
Species: Hu
Applications: AC

Publications for SLC24A3 Protein (NBP2-31010PEP) (0)

There are no publications for SLC24A3 Protein (NBP2-31010PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC24A3 Protein (NBP2-31010PEP) (0)

There are no reviews for SLC24A3 Protein (NBP2-31010PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SLC24A3 Protein (NBP2-31010PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for SLC24A3 Protein (NBP2-31010PEP)

Discover related pathways, diseases and genes to SLC24A3 Protein (NBP2-31010PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC24A3 Protein (NBP2-31010PEP)

Discover more about diseases related to SLC24A3 Protein (NBP2-31010PEP).
 

Pathways for SLC24A3 Protein (NBP2-31010PEP)

View related products by pathway.

PTMs for SLC24A3 Protein (NBP2-31010PEP)

Learn more about PTMs related to SLC24A3 Protein (NBP2-31010PEP).

Blogs on SLC24A3

There are no specific blogs for SLC24A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC24A3 Antibody
NBP2-31010

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC24A3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC24A3