SLC22A3 Antibody - BSA Free

Western Blot: SLC22A3 Antibody [NBP3-35881] - Western blot analysis of lysates from Mouse liver, using SLC22A3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3min.

• Reactivity: Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC22A3 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 289-349 of human SLC22A3 (NP_068812.1).
  
  Sequence:
  PESPRWLITRKKGDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC22A3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SLC22A3 Antibody - BSA Free

• EMTEMTH
• EMTH
• Extraneuronal monoamine transporter
• OCT3
• OCT3EMT organic cation transporter 3
• Organic cation transporter 3
• SLC22A3
• solute carrier family 22 (extraneuronal monoamine transporter), member 3
• solute carrier family 22 member 3

Background

SLC22A3 - solute carrier family 22 (extraneuronal monoamine transporter), member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC22A3