SLC1A5 Recombinant Protein Antigen

Images

 
There are currently no images for SLC1A5 Protein (NBP1-89328PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

SLC1A5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC1A5.

Source: E.coli

Amino Acid Sequence: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC1A5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89328.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for SLC1A5 Recombinant Protein Antigen

  • AAAT
  • ASCT2M7VS1
  • ATB(0)
  • Baboon M7 virus receptor
  • M7V1ATBO
  • neutral amino acid transporter B
  • neutral amino acid transporter B(0)
  • R16
  • RD114 virus receptor
  • RD114/simian type D retrovirus receptor
  • RDR
  • RDRCFLJ31068
  • Sodium-dependent neutral amino acid transporter type 2
  • solute carrier family 1 (neutral amino acid transporter), member 5
  • Solute carrier family 1 member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60038
Species: Hu
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-58952
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-93579
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro

Publications for SLC1A5 Protein (NBP1-89328PEP) (0)

There are no publications for SLC1A5 Protein (NBP1-89328PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC1A5 Protein (NBP1-89328PEP) (0)

There are no reviews for SLC1A5 Protein (NBP1-89328PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for SLC1A5 Protein (NBP1-89328PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC1A5 Products

Bioinformatics Tool for SLC1A5 Protein (NBP1-89328PEP)

Discover related pathways, diseases and genes to SLC1A5 Protein (NBP1-89328PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC1A5 Protein (NBP1-89328PEP)

Discover more about diseases related to SLC1A5 Protein (NBP1-89328PEP).
 

Pathways for SLC1A5 Protein (NBP1-89328PEP)

View related products by pathway.

PTMs for SLC1A5 Protein (NBP1-89328PEP)

Learn more about PTMs related to SLC1A5 Protein (NBP1-89328PEP).

Blogs on SLC1A5

There are no specific blogs for SLC1A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SLC1A5 Antibody
NBP1-89327
ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC1A5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A5