Slap Antibody


Western Blot: Slap Antibody [NBP1-52966] - OVCAR-3 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: Slap Antibody [NBP1-52966] - Human Spleen cell tissue, 4-8ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Slap Antibody Summary

Synthetic peptides corresponding to SLA(Src-like-adaptor) The peptide sequence was selected from the middle region of SLA. Peptide sequence PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against SLA and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Slap Antibody

  • hSLAP
  • SLA1
  • SLAP
  • SLAP1
  • SLAP-1
  • Src-like-adapter protein 1
  • Src-like-adapter
  • Src-like-adaptor


SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. SLA is involved in the negative regulation of positive selection and mit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Slap Antibody (NBP1-52966) (0)

There are no publications for Slap Antibody (NBP1-52966).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Slap Antibody (NBP1-52966) (0)

There are no reviews for Slap Antibody (NBP1-52966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Slap Antibody (NBP1-52966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Slap Products

Bioinformatics Tool for Slap Antibody (NBP1-52966)

Discover related pathways, diseases and genes to Slap Antibody (NBP1-52966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slap Antibody (NBP1-52966)

Discover more about diseases related to Slap Antibody (NBP1-52966).

Pathways for Slap Antibody (NBP1-52966)

View related products by pathway.

PTMs for Slap Antibody (NBP1-52966)

Learn more about PTMs related to Slap Antibody (NBP1-52966).

Blogs on Slap

There are no specific blogs for Slap, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Slap Antibody and receive a gift card or discount.


Gene Symbol SLA