SLAIN1 Antibody

Images

 
Western Blot: SLAIN1 Antibody [NBP1-70704] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLAIN1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLAIN1(SLAIN motif family, member 1) The peptide sequence was selected from the middle region of SLAIN1. Peptide sequence RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLAIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLAIN1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLAIN1 Antibody

  • SLAIN motif family, member 1
  • SLAIN1

Background

The exact function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-45225
Species: Hu, Mu, Rt, Ca
Applications: ICC/IF, PEP-ELISA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB500-182
Species: Hu, Mu, Rt, Ma
Applications: WB, ICC/IF, IP
H00009802-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
H00009167-B02P
Species: Hu
Applications: WB, ELISA
H00056899-P01
Species: Hu
NBP2-24619
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85568
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for SLAIN1 Antibody (NBP1-70704) (0)

There are no publications for SLAIN1 Antibody (NBP1-70704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLAIN1 Antibody (NBP1-70704) (0)

There are no reviews for SLAIN1 Antibody (NBP1-70704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLAIN1 Antibody (NBP1-70704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLAIN1 Products

SLAIN1 NBP1-70704

Bioinformatics Tool for SLAIN1 Antibody (NBP1-70704)

Discover related pathways, diseases and genes to SLAIN1 Antibody (NBP1-70704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLAIN1 Antibody (NBP1-70704)

Discover more about diseases related to SLAIN1 Antibody (NBP1-70704).
 

Pathways for SLAIN1 Antibody (NBP1-70704)

View related products by pathway.

PTMs for SLAIN1 Antibody (NBP1-70704)

Learn more about PTMs related to SLAIN1 Antibody (NBP1-70704).

Blogs on SLAIN1

There are no specific blogs for SLAIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLAIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLAIN1
Entrez